SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111024192|ref|YP_707164.1| from Rhodococcus jostii RHA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111024192|ref|YP_707164.1|
Domain Number 1 Region: 215-357
Classification Level Classification E-value
Superfamily CBS-domain pair 1.21e-26
Family CBS-domain pair 0.0039
Further Details:      
 
Domain Number 2 Region: 358-451
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.15e-20
Family CorC/HlyC domain-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111024192|ref|YP_707164.1|
Sequence length 456
Comment hypothetical protein RHA1_ro07242 [Rhodococcus jostii RHA1]
Sequence
MDIALSILALLGFLALTAGTALFVAAEFSLTALERSTVDSHARDGDRRARQVQHAHRTLS
FQLSGAQLGITITTLITGYLSEPVLARFITPVLSAIGFSESAAAATSLVIALVLATSFSM
VFGELVPKNLAIAHPLPTARATAGMQAAFSLIFKWAINGLNGTANWLVRRLGIEPAEELR
SARSPQELGSLVRTSAQRGAIDKGTALLVNRSLRFGERTAEELMTPRVKIVTLSTTDTVA
DLIDTASRTGFSRFPVVESDLDDAVGVVHIKHAFAVPAHRRRTARLNSLAQKVPVVPSSL
DGDALMERIRSDGMQVAFVVDEYGGTAGMVTMEDLIEEIVGDVRDEHDESEIDVQRVGDG
WSCSGLLRVDEVSDTTGYTAPEGEYETLGGLVLTELGRIPDEGDEVELPLPEGAHDPGGR
WVATVTHMDGRRIDRVLLTPKPDETGDTDSEEDDDE
Download sequence
Identical sequences Q0S0D0
101510.RHA1_ro07242 WP_011598916.1.53434 WP_011598916.1.60566 WP_011598916.1.78234 APC65117 gi|111024192|ref|YP_707164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]