SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110807505|ref|YP_691025.1| from Shigella flexneri 5 str. 8401

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110807505|ref|YP_691025.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.06e-39
Family Frataxin-like 0.000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110807505|ref|YP_691025.1|
Sequence length 106
Comment frataxin-like protein [Shigella flexneri 5 str. 8401]
Sequence
MNDSEFHRLADQLWLTIEERLDDRDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQV
WLATKQGGSHFDLKGDEWICDRSGETFWDLLEQAATQQAGETVSFR
Download sequence
Identical sequences A0A0F6MIH4 Q0SYZ5
WP_000999938.1.41372 WP_000999938.1.67802 gi|110807505|ref|YP_691025.1| 373384.SFV_3695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]