SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153931007|ref|YP_001382622.1| from Clostridium botulinum A str. ATCC 19397

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153931007|ref|YP_001382622.1|
Domain Number 1 Region: 3-278
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.25e-85
Family DegV-like 0.00000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153931007|ref|YP_001382622.1|
Sequence length 279
Comment DegV family protein [Clostridium botulinum A str. ATCC 19397]
Sequence
MEKIKIITDSTADLPKDIIEKYDIEVIPLFVSFGDKVYKDGVDIKLEQLFTKIEKENVFP
QTSQVNPQRFYEYYKKYIDKGYSIISIHISSKMSGTYQSACLAKDMLDSDNIIVIDSNNV
TSGLGLLVIKACKLKDEGLFIEEIVKGVKETIPHIKSVLAFETLDYLVKGGRLSKTAGFI
GNVLGIKPILAVENGEMVVKDKVRGSKKAIRAIFEYIGKLGLKQGEPCILLHVQNKDILG
TLRENLNQDEANFIECTVGCVVGIYAGPRACGIFFIEDY
Download sequence
Identical sequences gi|153935282|ref|YP_001386174.1| WP_011986043.1.63111 YP_001386174.1.17653 gi|153931007|ref|YP_001382622.1| 441770.CLB_0259 441771.CLC_0274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]