SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153932627|ref|YP_001383349.1| from Clostridium botulinum A str. ATCC 19397

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153932627|ref|YP_001383349.1|
Domain Number 1 Region: 1-331
Classification Level Classification E-value
Superfamily DAK1/DegV-like 3.66e-121
Family DAK1 0.000000179
Further Details:      
 
Domain Number 2 Region: 360-583
Classification Level Classification E-value
Superfamily DhaL-like 2.22e-45
Family DhaL-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153932627|ref|YP_001383349.1|
Sequence length 586
Comment dihydroxyacetone kinase [Clostridium botulinum A str. ATCC 19397]
Sequence
MKKIINRPETVVMEMCNGIAMAHPELEFVRKYKVMKKKNINKNKVSLISGGGSGHEPAHA
GFIGKGMLDAAVCGDIFASPSQIQVYKAIKATASEKGTLLIIKNYSGDIMNFKNAAHLAS
EDGIKVDYVKVDDDIAVEDSLYTVGRRGVAGTVLVHKIAGAAAELGFSLEKVKSIAEKAV
SNVRSLGFAFSSCTVPAKRTPTFQLAEDEMEFGVGIHGEPGIVREKVATADELAKKIVDS
ILKDMKIDGSNNEEVALLINGFGATPLQELYLFNNSVTAELAKKNIKINRTFVGNYMTSI
DMEGASVSIMKLDDELKELLSKESDTPAFKVSGPVESVEYISLEDNNDIENEVSFDLETC
ECHSEIKDKKITLDNMIYIIDKMSEVIIANEVHFCELDSHAGDGDFGMSVAKGFKQLKRE
WKHILKEDNMNIGKFLNECSLIIMEHCGGASGPIWGSAFRSAGKQVGDKKELSVSDFAQM
MQAAVKGIQATGERSFGRGAVVGDKTLIDALVPCADLWSESANNNTSIHEAFQKGAAAAV
KGAKMTEEIVARMGRAGTVGERSIGYPDAGAYGLGVIFTEISNSLK
Download sequence
Identical sequences A0A0M1L9A9 A5I0G7
gi|148378967|ref|YP_001253508.1| WP_011948658.1.10598 WP_011948658.1.21778 WP_011948658.1.25111 WP_011948658.1.27088 WP_011948658.1.28409 WP_011948658.1.34822 WP_011948658.1.46754 WP_011948658.1.57120 WP_011948658.1.63111 WP_011948658.1.63218 WP_011948658.1.64959 WP_011948658.1.65258 WP_011948658.1.73124 WP_011948658.1.75721 WP_011948658.1.92266 YP_001253508.1.75347 YP_001386897.1.17653 gi|153936385|ref|YP_001386897.1| gi|153932627|ref|YP_001383349.1| 413999.CBO0975 441770.CLB_1015 441771.CLC_1029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]