SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153932867|ref|YP_001382979.1| from Clostridium botulinum A str. ATCC 19397

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153932867|ref|YP_001382979.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily DAK1/DegV-like 2.56e-78
Family DegV-like 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153932867|ref|YP_001382979.1|
Sequence length 288
Comment degV family protein [Clostridium botulinum A str. ATCC 19397]
Sequence
MEKIALITDTTSDLPEDILEKYNIKQLAFRIIYKDRELKDRFDITSKEVYENLEVEVPTS
SLPSMEDMDNLFTELEEEGYTHVIAVVLSSGLSGIYNGMKIVSENHPKLTTYICDSKSIS
LGEGVLLMESARMLEEGKSFNQIVEAIPKIRENVKTFFVVGTLEYLKKGGRIGKVAGTIA
ELLNIKPIISIDNEDGKYYTYTKVRGRKQSLANLIDIAKEFLEKGKCKIYVMHGNAEEEA
KAVFEKLKNLPNVTFAMLGGCISPVSGAHSGPGLVGVACLRDMDYCGN
Download sequence
Identical sequences A0A0A2HDG5 A0A0E1L262 A0A175M259 A5HZD4 C1FT65
gi|148378591|ref|YP_001253132.1| gi|226947845|ref|YP_002802936.1| gi|153936915|ref|YP_001386525.1| WP_003356136.1.101837 WP_003356136.1.10598 WP_003356136.1.14220 WP_003356136.1.14863 WP_003356136.1.15773 WP_003356136.1.16702 WP_003356136.1.16999 WP_003356136.1.17007 WP_003356136.1.17634 WP_003356136.1.18143 WP_003356136.1.19327 WP_003356136.1.20373 WP_003356136.1.21778 WP_003356136.1.25111 WP_003356136.1.26119 WP_003356136.1.27088 WP_003356136.1.27859 WP_003356136.1.28306 WP_003356136.1.28409 WP_003356136.1.29491 WP_003356136.1.32894 WP_003356136.1.34328 WP_003356136.1.34822 WP_003356136.1.36253 WP_003356136.1.36784 WP_003356136.1.42818 WP_003356136.1.43055 WP_003356136.1.44945 WP_003356136.1.45672 WP_003356136.1.46754 WP_003356136.1.46996 WP_003356136.1.47789 WP_003356136.1.49498 WP_003356136.1.49536 WP_003356136.1.49637 WP_003356136.1.49727 WP_003356136.1.50688 WP_003356136.1.50747 WP_003356136.1.51228 WP_003356136.1.51581 WP_003356136.1.52140 WP_003356136.1.5276 WP_003356136.1.56340 WP_003356136.1.5655 WP_003356136.1.57003 WP_003356136.1.57050 WP_003356136.1.57120 WP_003356136.1.57916 WP_003356136.1.59839 WP_003356136.1.59927 WP_003356136.1.61167 WP_003356136.1.63111 WP_003356136.1.63218 WP_003356136.1.65258 WP_003356136.1.67470 WP_003356136.1.67940 WP_003356136.1.69035 WP_003356136.1.69463 WP_003356136.1.69692 WP_003356136.1.70928 WP_003356136.1.73124 WP_003356136.1.74799 WP_003356136.1.75721 WP_003356136.1.76938 WP_003356136.1.77051 WP_003356136.1.79827 WP_003356136.1.80865 WP_003356136.1.8456 WP_003356136.1.87449 WP_003356136.1.87856 WP_003356136.1.88000 WP_003356136.1.90975 WP_003356136.1.9205 WP_003356136.1.92266 WP_003356136.1.93232 WP_003356136.1.93526 WP_003356136.1.94833 WP_003356136.1.95223 WP_003356136.1.95482 WP_003356136.1.95863 WP_003356136.1.9587 WP_003356136.1.96382 WP_003356136.1.96416 WP_003356136.1.96493 WP_003356136.1.96844 WP_003356136.1.97020 WP_003356136.1.9927 WP_003356136.1.99682 YP_001253132.1.75347 YP_001386525.1.17653 413999.CBO0590 441770.CLB_0631 441771.CLC_0645 515621.CLJ_B0678 536232.CLM_0700 gi|153932867|ref|YP_001382979.1| gi|387816864|ref|YP_005677208.1| gi|237793928|ref|YP_002861480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]