SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153933657|ref|YP_001384772.1| from Clostridium botulinum A str. ATCC 19397

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153933657|ref|YP_001384772.1|
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily Replisome organizer (g39p helicase loader/inhibitor protein) 0.0000301
Family Replisome organizer (g39p helicase loader/inhibitor protein) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153933657|ref|YP_001384772.1|
Sequence length 180
Comment hypothetical protein CLB_2468 [Clostridium botulinum A str. ATCC 19397]
Sequence
MILEETIKILSIIKAAYPQWARDLKPTDAKTMVNLWSTMLEDYPYNVVQIAIKKIIATNK
FPPSVAEVIEAINYITSGGKSEMTEIEAWGLVRKAIKNSAYNAEEEFNKLPEKIQQAIGS
HNILHNWSQETVDGIEKVIGSNFMRSYKATVIRKKEEKQLPSSIKKMLGNVGQKMIEGDK
Download sequence
Identical sequences WP_012099393.1.63111 gi|153933657|ref|YP_001384772.1| 441770.CLB_2468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]