SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374314601|ref|YP_005061029.1| from Sphaerochaeta pleomorpha str. Grapes

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374314601|ref|YP_005061029.1|
Domain Number 1 Region: 15-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.94e-63
Family Phosphate binding protein-like 0.0000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374314601|ref|YP_005061029.1|
Sequence length 261
Comment periplasmic component of amino acid ABC-type transporter/signal transduction system [Sphaerochaeta pleomorpha str. Grapes]
Sequence
MKITKKLGFVLVTVVLLGFFSNSLVFANGTKESPATIAFAGSGGYPPFNYMTDEGSVIGF
DVDVAKEIAKRLGKEMEYKTTAWDGIIEGLRAKRYDAILGSMGITEAREKVVDFSIPYYY
SGPQLIVRRDSTIKGVSDLKATSRVGLVTGTTFEEDAAKLGVVTKLYEDDNQTLMELING
RLDGVLTDRIVGLNAIGKLQGGEQLMLVGSVLRSEKMGIAFHDGDDALRTQVNAILVQMQ
EDGTLATISAKWFGGEDITHE
Download sequence
Identical sequences G8QTQ4
gi|374314601|ref|YP_005061029.1| WP_014268868.1.23014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]