SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374314662|ref|YP_005061090.1| from Sphaerochaeta pleomorpha str. Grapes

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374314662|ref|YP_005061090.1|
Domain Number 1 Region: 25-480
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.35e-118
Family Pyridoxal-dependent decarboxylase 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374314662|ref|YP_005061090.1|
Sequence length 487
Comment PLP-dependent enzyme, glutamate decarboxylase [Sphaerochaeta pleomorpha str. Grapes]
Sequence
MQNDNIEPLFLSSSKESKEAYRAIIESTVTAILDSMQDEKAYRGMNPRQLQQEISSQTLL
PEQGLGFPSVLDSVSKSIIPNFLKTSSTDYMAHLHSPALLESIASELILSTFNQSMDSWD
QSPIATEVEIAVIKQLCIMYGIKEHSDGVFTSGGSQSNLSGITLARDWYCNTKLHHDVKK
EGLPSCYSKFRIYTSEVSHFSMEKSAHLLGLGYNAVVKVKVDAQCKMDCKALEKHIEQDK
EQGFLPIAVIATIGTTDYGSIDPIGEISAICKKEGLWLHGDAAYGSGVILSGKYAHRIAS
IDCCDSLTVDFHKMFLLPISCGAFLVKEGKNLEAFTLHADYLNREEDEEDGYTNLVGKSL
QTTRRFDALKVWMAFQVRGKAGYAAIIDTCIENATYVYERLCLNNAFEVAIQPEISSVVF
RLKGSCEVNKRVRRRLIHFQGVVIGQTVYQEKTYLKFTLLNPTVTHEKLDSLLSLIEELG
IEESKQA
Download sequence
Identical sequences G8QUB0
WP_014268929.1.23014 gi|374314662|ref|YP_005061090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]