SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119357520|ref|YP_912164.1| from Chlorobium phaeobacteroides DSM 266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119357520|ref|YP_912164.1|
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.46e-93
Family Methylenetetrahydrofolate reductase 0.000000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119357520|ref|YP_912164.1|
Sequence length 289
Comment 5,10-methylenetetrahydrofolate reductase [Chlorobium phaeobacteroides DSM 266]
Sequence
MLVREILNSTSEPVFSFEFFPPKKEEEWNTLFATIASLTSLNPSYVSVTYGAGGSTRSKT
HDLVTRIQKETGITVVSHLTCVCSDREETSSILENYLENGINNVLALRGDKPQGVATLAE
AIKDFEHAADLIRFIKIRFPAIGIGVAGFPEGHPETPNRLKEIDYLKEKIDAGADYIVTQ
LFFDNRDYFDYVERCAIAGITVPIIAGIMPVSTKKGMIRMSELALGARIPAPLLKQVLES
DSDRDVAEIGIDWATRQVQELIDQQCKGIHFYTLNLADATLKIFRNIRQ
Download sequence
Identical sequences A1BH63
290317.Cpha266_1723 WP_011745549.1.8298 gi|119357520|ref|YP_912164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]