SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119357809|ref|YP_912453.1| from Chlorobium phaeobacteroides DSM 266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119357809|ref|YP_912453.1|
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily Folate-binding domain 4.4e-99
Family Aminomethyltransferase folate-binding domain 0.000000886
Further Details:      
 
Domain Number 2 Region: 274-362
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.62e-19
Family Aminomethyltransferase beta-barrel domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119357809|ref|YP_912453.1|
Sequence length 365
Comment glycine cleavage system aminomethyltransferase T [Chlorobium phaeobacteroides DSM 266]
Sequence
MKKTALYHWHEQAGARIIDFGGYLMPVQYSGIIAEHRAVRSAAGLFDVSHMGNFYVTGER
SEAFLQYMVTNDLSKVRDGEAQYNLMLYPNGGVVDDLIIYRLDSKTFFLIVNASNTEKDY
AWLQQHIGAFDGVCLEDHTDRLSLIALQGPVAIDIVKTVFPSVDFDALLQFQFCRTLYGD
APVMIARTGYTGEKGVEICLPNEAALPLWEALYDAGRACGISPVGLGARDTLRLEMGYSL
YGHEIDQDINPLEARLKWAVKMDKGSFIGREACQQVELHLTRGVAGFSIESRVLPRQHCK
VYNTDRQEIGWVCSGTLSPTLQEPIGTCNIVRKYITSGDSVFVDVRGTLHKGEIRRLPFV
KTSLG
Download sequence
Identical sequences A1BI02
gi|119357809|ref|YP_912453.1| 290317.Cpha266_2017 WP_011745833.1.8298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]