SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119357665|ref|YP_912309.1| from Chlorobium phaeobacteroides DSM 266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119357665|ref|YP_912309.1|
Domain Number 1 Region: 102-316
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 3.79e-52
Family MurCDEF 0.00067
Further Details:      
 
Domain Number 2 Region: 319-471
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.92e-31
Family MurCDEF C-terminal domain 0.0025
Further Details:      
 
Domain Number 3 Region: 2-91
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 1.2e-20
Family MurCD N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119357665|ref|YP_912309.1|
Sequence length 474
Comment UDP-N-acetylmuramate--L-alanine ligase [Chlorobium phaeobacteroides DSM 266]
Sequence
MSSIYFLGIGGTAMASVAVALSHSGHAVSGSDTQLYPPMSNYLDTHNIRYFSGFSEENIQ
KASADLVVAGNAISRGNIELEYALNNRMELISMPDLVRRELIAQNTSLVVTGTHGKTTTT
SLLAWLLQHGGLKPGFLVGGIPENFPVACRASGRSENGFFVSEGDEYDTAFFDKRSKFLL
YRPDVVIINNIEFDHADIFNSLDDIKRSFRLLVNLIPGNGLLLVNGDAPDALAVASRAFC
RVERFGLNGNSEWSARNISLENSLTGFDLYYKGNLQGTCHVPLFGSHNIMNTIAAVAAAI
HSGISFDSIAAGLPLFKRPKRRMEITDDSANRITLIEDFAHHPTAVKATLEAIADLYPKR
RIIACFEPRSNTTTRNIFQNELAACFDPASIVIMGMVHRPERYRPEERLDTERLKNELEN
KGKTVFLAGENPSIYPQDIIGFITTRLQPEDVVVLLSNGSFSNLKQGLFDSLKK
Download sequence
Identical sequences A1BHK8
WP_011745692.1.8298 gi|119357665|ref|YP_912309.1| 290317.Cpha266_1869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]