SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119358484|ref|YP_913128.1| from Chlorobium phaeobacteroides DSM 266

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119358484|ref|YP_913128.1|
Domain Number 1 Region: 93-308
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 2.35e-66
Family MurCDEF 0.0000146
Further Details:      
 
Domain Number 2 Region: 310-456
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 2.93e-39
Family MurCDEF C-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 7-94
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 1.96e-23
Family MurCD N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119358484|ref|YP_913128.1|
Sequence length 466
Comment UDP-N-acetylmuramate--L-alanine ligase [Chlorobium phaeobacteroides DSM 266]
Sequence
MELGKTKSVHIVGIGGAGMSAIAELLLTSGFGVTGSDLSSGEVTERLSERGAVIYQGHKA
EQVGESDVVVYSSAIRPAENVEIVAAEQAGIPVIKRDEMLGELMRYNYGVCVSGTHGKTT
TTAMIATMLIEAGESPTVMIGGVSDYLKGSTVVGSGKYLVIEADEFDRAFLKLTPTIAVI
NSLESEHMDTYGTIEELRKAFIAFANKVPFYGRVICCVDWPEIRKLIPHLNRRYTTFGID
EPADVMASDMVMDKNRSRFTVRASGKEYPGVSLNVPGRHNVMNALAAFASGLELGIAPER
IIAGLTRYSGMRRRFQIKYDNSAGVLVVDDYAHHPSEVKAAVKAARDGWPNAEIVAVFQP
HLFSRTREFADEYGWALLRADKIYVADIYPSREKAADYPGVSGSLVAAAVHKAGGKHAEF
IADRELLYQTVETCPQKSTVVLFMGAGDITHLSTRLAGEWINKFSA
Download sequence
Identical sequences A1BJX7
gi|119358484|ref|YP_913128.1| 290317.Cpha266_2720 WP_015961231.1.8298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]