SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114562685|ref|YP_750198.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114562685|ref|YP_750198.1|
Domain Number 1 Region: 639-808
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.02e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 4-193
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0033
Further Details:      
 
Domain Number 3 Region: 151-311
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0068
Further Details:      
 
Domain Number 4 Region: 516-647
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.19e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|114562685|ref|YP_750198.1|
Sequence length 867
Comment nitrite reductase (NAD(P)H) large subunit [Shewanella frigidimarina NCIMB 400]
Sequence
MAVSKPKLVVVGNGMVGHHFIEQLCSLGLNKTFDVHVFGEEPRPAYDRVQLSKYFETGSA
DPLMLTSAQDYQDWGITLHLNTPITAIDIAAKTVTSAQGDHYSYTRLVLATGSFPFVPPI
QGNDRAQCLVYRTIEDLEAIQAAAQNSQVGVVVGGGLLGLEAANAMMQLGVKTHVVEFAP
QLMPVQLNDKAGELLCSKIEQLGVSVHTSKATTAIIDGETAMHRMTFNDESYLETDMIVF
SAGIRPQDSLARISNISIGERGGIEIDDYCLTSAPDVYAIGECALWQQKIFGLVAPGYQM
ARVVASHIASLTSNSVSQSFTGADMSTKLKLLGVDVVAIGASRGFDNAQFVELSDNHAGI
YKKLWLDETGKFLKGAVLIGDNSDYSRLLDSYLSQDEIEGSAVELLLAGAENEADLKDTS
IVCSCHQVTKGDIVEAVTAGNHKMAEIKSCTRAASGCGGCAPLVQKIIDQTLQAAGLDFN
AGICAHFDHDRQALYHLCQVEGINDFNTLITLHGKPSASGHAYGCDICKPAAASIFASLQ
NHYVLDQNLGHVQLQDTNDAYLGNIQKDGTYSIVPRVAGGEITPTKLIAMGQIAQEYDLY
TKITGGQRIDMFGATLSQLPEIWKKLIDAGFETGHAYGKSLRTVKSCVGSTWCRYGVQDA
VGFAIDLENRYKGLRSPHKLKFAVSGCTRECAEAQSKDIGIIATDKGWNLYVAGNGGMRP
RHGDLFATDLSTQDLYKYIDRILMFYVKTADKLQRTSTWMDSLEGGLAYLKSVVIDDALG
INSILEQQMDHIAATYQCEWKTSLEQPAFLARFNEFVNPSDAPEADTSAYQRIREQRFPS
IKDAGAGTIAIKDITDDAAQLAVEELA
Download sequence
Identical sequences Q084F5
gi|114562685|ref|YP_750198.1| 318167.Sfri_1509 WP_011636980.1.15765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]