SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114564353|ref|YP_751867.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114564353|ref|YP_751867.1|
Domain Number 1 Region: 140-336
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-56
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000433
Further Details:      
 
Domain Number 2 Region: 423-554
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.63e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000241
Further Details:      
 
Domain Number 3 Region: 9-139
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.39e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0011
Further Details:      
 
Domain Number 4 Region: 338-413
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.91e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114564353|ref|YP_751867.1|
Sequence length 563
Comment sulfite reductase subunit beta [Shewanella frigidimarina NCIMB 400]
Sequence
MSEQKLALNEYLKIDSDYLRGDIQEGLDTQVTGSFSDGDQQLIKFHGFYQQDDRDLRNER
KEQKLEPLHSFMLRARVPGGICTPAQWLEVDKISSTLTTSNSIRLTTRQTFQYHGIPKRN
LKTLIQGLDRAALDSIAACGDVNRNVMCNPNPVESKLHAQAYAVAKHLSDHLLPHTRAYA
EIWLDEEKLLGTETVEPVYGKTYLPRKFKMAVAVPPHNDVDVYTNDLGFIAVSEAGELIG
FNLVAGGGMGSTHGEVETFPRLADDFGFIKTDDVTKFAEAVMTVQRDWGNRVVRKRARLK
YTIVDHGYDAFKAEVEKRAGVKFEPKRDVIIGDRGDRYGWVEGIDNKFHLTLFIESGRIK
DMPGQTLQTGLREIAKIHKGDFRMTSNQNMIIAGVAAQDKAEIEGLARKHGLLGQVLSGT
RGHSIACVALPTCPLAMAEAERYFPEFIDHIDALQAKHGISEQSIVVRMTGCPNGCARPF
AAEIGLVGKAPGRYNLYLGASFEGTRLNKMHKENIQEAEILAELDTLFGRYATERDAGET
FGNFTVRIGVVKAVNDAAKDFHA
Download sequence
Identical sequences Q07Y86
gi|114564353|ref|YP_751867.1| 318167.Sfri_3192 WP_011638631.1.15765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]