SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114562806|ref|YP_750319.1| from Shewanella frigidimarina NCIMB 400

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114562806|ref|YP_750319.1|
Domain Number 1 Region: 457-552
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000145
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|114562806|ref|YP_750319.1|
Sequence length 600
Comment sulfate transporter [Shewanella frigidimarina NCIMB 400]
Sequence
MITTYFIIIEVVVLLSRLYGFMPGLETFSRYERSWLKDDVRAGLSVAAVALPVAIAYAQL
TGVNAAVGLYSCVLPMLIYALFGTSRQLIVGPDAATCAVIAAVVTPLAAGDSLKHWQLVM
TMTVMTGFWCLIASRFKLGVLADFLSKPILMGLLNGVAITIIVGQFSKIFGFTFDEKYLL
ERLGGAPSYLSQTHIPTLLMAILTVVVYFVMKRLKPTWPASMFAIAVGGALVWAFHLTDY
DVAVIGSVAGGLPSFQAPVFNIGIARELVMPALNLAMVSFVSMMLTARSFAAKNGYDIDA
DKEFKALGLANIASALSQGFAVSGADSRTAVNDANGGKTQLVSVIAAVLIAVVAVFLTAP
LEFIPSAALGVVLVIASVHLIDLKAIWGLRLRDRQAFYLALTTFLAVLFIGVIPGITLAV
LLGLFQFLRTVMRPTDQVLGLDAKGIIRSLDSSDKASSVPGVFIYRFNSPLTYFNATYFK
RRLLERFARQNQLETVECVIIDAVPCFTHLDLSVMAMLTDIDVLLRKRGVSLVLAGRKRQ
LISWFEQTDMVSGEEGITIRSDLYLALKMQQSHVAACEAQQLDDSHSDDSTETVLTHSQI
Download sequence
Identical sequences Q083T4
318167.Sfri_1630 gi|114562806|ref|YP_750319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]