SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126697707|ref|YP_001086604.1| from Clostridium difficile 630

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126697707|ref|YP_001086604.1|
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.22e-37
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126697707|ref|YP_001086604.1|
Sequence length 102
Comment PTS system lactose/cellobiose-family transporter subunit IIA [Clostridium difficile 630]
Sequence
MEEIVLKIIIHAGNAKSMLYEALDYAKENDFKKADELIENANEEILKAHKVQTELIQKEA
GGDKSDISILLIHSQDHLMTCMSERNLIKEMIMLRKEIQKLK
Download sequence
Identical sequences A0A031WEM4 A0A0H3MYC5 A0A0J0U7K8 A0A125V1E1 A0A1F2DC03 A0A2I2JLW7 C9YHU3 D5Q970 D5S4R3 G6B2Z9 G6BHR4 Q18CM9 T4ILK7 U3UCI1 U3V008 U3V8X9
gi|126697707|ref|YP_001086604.1| gi|384359465|ref|YP_006197317.1| WP_003420747.1.100055 WP_003420747.1.100097 WP_003420747.1.100099 WP_003420747.1.100107 WP_003420747.1.100118 WP_003420747.1.100139 WP_003420747.1.100513 WP_003420747.1.100570 WP_003420747.1.100660 WP_003420747.1.100831 WP_003420747.1.100923 WP_003420747.1.100977 WP_003420747.1.101035 WP_003420747.1.101125 WP_003420747.1.101279 WP_003420747.1.10130 WP_003420747.1.101316 WP_003420747.1.101532 WP_003420747.1.101861 WP_003420747.1.101929 WP_003420747.1.102031 WP_003420747.1.102074 WP_003420747.1.102095 WP_003420747.1.10483 WP_003420747.1.10488 WP_003420747.1.10582 WP_003420747.1.10691 WP_003420747.1.10793 WP_003420747.1.10795 WP_003420747.1.11025 WP_003420747.1.11224 WP_003420747.1.11278 WP_003420747.1.11320 WP_003420747.1.11372 WP_003420747.1.11398 WP_003420747.1.1167 WP_003420747.1.1179 WP_003420747.1.11937 WP_003420747.1.11959 WP_003420747.1.12066 WP_003420747.1.12169 WP_003420747.1.12385 WP_003420747.1.1254 WP_003420747.1.12629 WP_003420747.1.12632 WP_003420747.1.12659 WP_003420747.1.1273 WP_003420747.1.12734 WP_003420747.1.12807 WP_003420747.1.12809 WP_003420747.1.12953 WP_003420747.1.13040 WP_003420747.1.13251 WP_003420747.1.13273 WP_003420747.1.13398 WP_003420747.1.13418 WP_003420747.1.13730 WP_003420747.1.13823 WP_003420747.1.13841 WP_003420747.1.13859 WP_003420747.1.14045 WP_003420747.1.141 WP_003420747.1.14170 WP_003420747.1.14177 WP_003420747.1.14205 WP_003420747.1.1422 WP_003420747.1.14259 WP_003420747.1.14330 WP_003420747.1.14352 WP_003420747.1.1445 WP_003420747.1.14457 WP_003420747.1.14483 WP_003420747.1.14579 WP_003420747.1.14674 WP_003420747.1.14686 WP_003420747.1.14698 WP_003420747.1.14848 WP_003420747.1.1494 WP_003420747.1.15083 WP_003420747.1.15097 WP_003420747.1.15192 WP_003420747.1.15205 WP_003420747.1.15310 WP_003420747.1.15435 WP_003420747.1.15908 WP_003420747.1.16012 WP_003420747.1.16135 WP_003420747.1.16185 WP_003420747.1.16376 WP_003420747.1.16520 WP_003420747.1.16728 WP_003420747.1.16897 WP_003420747.1.169 WP_003420747.1.16931 WP_003420747.1.16966 WP_003420747.1.1705 WP_003420747.1.17371 WP_003420747.1.17413 WP_003420747.1.17463 WP_003420747.1.17512 WP_003420747.1.17611 WP_003420747.1.17638 WP_003420747.1.17808 WP_003420747.1.17851 WP_003420747.1.17879 WP_003420747.1.17908 WP_003420747.1.17960 WP_003420747.1.17998 WP_003420747.1.18060 WP_003420747.1.18207 WP_003420747.1.18212 WP_003420747.1.18298 WP_003420747.1.1838 WP_003420747.1.18407 WP_003420747.1.18455 WP_003420747.1.18462 WP_003420747.1.18551 WP_003420747.1.18680 WP_003420747.1.18805 WP_003420747.1.18970 WP_003420747.1.19088 WP_003420747.1.19152 WP_003420747.1.1926 WP_003420747.1.19290 WP_003420747.1.1934 WP_003420747.1.19648 WP_003420747.1.19704 WP_003420747.1.19899 WP_003420747.1.19956 WP_003420747.1.1999 WP_003420747.1.2002 WP_003420747.1.20132 WP_003420747.1.20184 WP_003420747.1.20302 WP_003420747.1.20313 WP_003420747.1.20481 WP_003420747.1.20650 WP_003420747.1.20728 WP_003420747.1.20872 WP_003420747.1.20875 WP_003420747.1.20960 WP_003420747.1.21000 WP_003420747.1.21048 WP_003420747.1.21201 WP_003420747.1.21220 WP_003420747.1.21417 WP_003420747.1.21502 WP_003420747.1.21520 WP_003420747.1.21547 WP_003420747.1.21618 WP_003420747.1.21704 WP_003420747.1.21893 WP_003420747.1.21925 WP_003420747.1.21980 WP_003420747.1.22020 WP_003420747.1.22079 WP_003420747.1.22128 WP_003420747.1.22222 WP_003420747.1.22228 WP_003420747.1.22313 WP_003420747.1.22357 WP_003420747.1.22395 WP_003420747.1.22411 WP_003420747.1.22417 WP_003420747.1.22568 WP_003420747.1.22569 WP_003420747.1.22615 WP_003420747.1.22768 WP_003420747.1.22893 WP_003420747.1.22937 WP_003420747.1.23096 WP_003420747.1.23208 WP_003420747.1.23287 WP_003420747.1.23338 WP_003420747.1.2363 WP_003420747.1.24197 WP_003420747.1.24457 WP_003420747.1.24520 WP_003420747.1.24826 WP_003420747.1.24889 WP_003420747.1.24900 WP_003420747.1.24987 WP_003420747.1.25128 WP_003420747.1.25416 WP_003420747.1.25761 WP_003420747.1.26024 WP_003420747.1.26044 WP_003420747.1.26358 WP_003420747.1.26482 WP_003420747.1.26494 WP_003420747.1.26697 WP_003420747.1.26829 WP_003420747.1.26940 WP_003420747.1.27300 WP_003420747.1.27563 WP_003420747.1.2758 WP_003420747.1.27677 WP_003420747.1.27708 WP_003420747.1.27824 WP_003420747.1.27872 WP_003420747.1.27881 WP_003420747.1.27890 WP_003420747.1.27967 WP_003420747.1.27989 WP_003420747.1.27996 WP_003420747.1.28055 WP_003420747.1.28410 WP_003420747.1.28638 WP_003420747.1.28715 WP_003420747.1.28856 WP_003420747.1.28882 WP_003420747.1.28890 WP_003420747.1.28930 WP_003420747.1.2923 WP_003420747.1.293 WP_003420747.1.29600 WP_003420747.1.29757 WP_003420747.1.2982 WP_003420747.1.29891 WP_003420747.1.29939 WP_003420747.1.3024 WP_003420747.1.303 WP_003420747.1.3031 WP_003420747.1.30420 WP_003420747.1.30431 WP_003420747.1.30463 WP_003420747.1.30519 WP_003420747.1.30521 WP_003420747.1.30743 WP_003420747.1.30841 WP_003420747.1.30953 WP_003420747.1.31160 WP_003420747.1.31183 WP_003420747.1.31203 WP_003420747.1.31292 WP_003420747.1.31309 WP_003420747.1.31351 WP_003420747.1.31385 WP_003420747.1.31453 WP_003420747.1.31475 WP_003420747.1.31477 WP_003420747.1.31519 WP_003420747.1.31637 WP_003420747.1.31719 WP_003420747.1.31742 WP_003420747.1.31960 WP_003420747.1.31969 WP_003420747.1.32008 WP_003420747.1.32066 WP_003420747.1.32119 WP_003420747.1.32166 WP_003420747.1.32197 WP_003420747.1.32218 WP_003420747.1.32230 WP_003420747.1.32294 WP_003420747.1.32699 WP_003420747.1.32769 WP_003420747.1.32776 WP_003420747.1.32842 WP_003420747.1.32953 WP_003420747.1.33056 WP_003420747.1.33098 WP_003420747.1.33164 WP_003420747.1.33275 WP_003420747.1.33298 WP_003420747.1.33332 WP_003420747.1.33349 WP_003420747.1.3340 WP_003420747.1.33514 WP_003420747.1.33810 WP_003420747.1.34388 WP_003420747.1.34489 WP_003420747.1.34545 WP_003420747.1.34641 WP_003420747.1.34800 WP_003420747.1.34985 WP_003420747.1.34989 WP_003420747.1.35 WP_003420747.1.35002 WP_003420747.1.35137 WP_003420747.1.35181 WP_003420747.1.35187 WP_003420747.1.35234 WP_003420747.1.3559 WP_003420747.1.35832 WP_003420747.1.35884 WP_003420747.1.36078 WP_003420747.1.36257 WP_003420747.1.36338 WP_003420747.1.36738 WP_003420747.1.36835 WP_003420747.1.37255 WP_003420747.1.374 WP_003420747.1.37493 WP_003420747.1.37532 WP_003420747.1.37597 WP_003420747.1.37861 WP_003420747.1.3789 WP_003420747.1.37957 WP_003420747.1.37981 WP_003420747.1.38305 WP_003420747.1.38338 WP_003420747.1.38692 WP_003420747.1.38775 WP_003420747.1.38814 WP_003420747.1.38874 WP_003420747.1.38924 WP_003420747.1.38986 WP_003420747.1.39008 WP_003420747.1.3913 WP_003420747.1.39213 WP_003420747.1.39350 WP_003420747.1.39382 WP_003420747.1.39442 WP_003420747.1.39525 WP_003420747.1.39621 WP_003420747.1.39783 WP_003420747.1.39874 WP_003420747.1.39876 WP_003420747.1.39975 WP_003420747.1.39981 WP_003420747.1.40030 WP_003420747.1.40313 WP_003420747.1.40447 WP_003420747.1.40516 WP_003420747.1.40522 WP_003420747.1.40557 WP_003420747.1.407 WP_003420747.1.40775 WP_003420747.1.40891 WP_003420747.1.40959 WP_003420747.1.40966 WP_003420747.1.41131 WP_003420747.1.4121 WP_003420747.1.41334 WP_003420747.1.41342 WP_003420747.1.4137 WP_003420747.1.41506 WP_003420747.1.41534 WP_003420747.1.41641 WP_003420747.1.41687 WP_003420747.1.41818 WP_003420747.1.41995 WP_003420747.1.42035 WP_003420747.1.4204 WP_003420747.1.42066 WP_003420747.1.42532 WP_003420747.1.42533 WP_003420747.1.42610 WP_003420747.1.42664 WP_003420747.1.43112 WP_003420747.1.4315 WP_003420747.1.4321 WP_003420747.1.43388 WP_003420747.1.43490 WP_003420747.1.43519 WP_003420747.1.43579 WP_003420747.1.43663 WP_003420747.1.43824 WP_003420747.1.4383 WP_003420747.1.44030 WP_003420747.1.44105 WP_003420747.1.44149 WP_003420747.1.44198 WP_003420747.1.44241 WP_003420747.1.44470 WP_003420747.1.44471 WP_003420747.1.44729 WP_003420747.1.45017 WP_003420747.1.45059 WP_003420747.1.45142 WP_003420747.1.45165 WP_003420747.1.45209 WP_003420747.1.45257 WP_003420747.1.45352 WP_003420747.1.45554 WP_003420747.1.4573 WP_003420747.1.45938 WP_003420747.1.45986 WP_003420747.1.46066 WP_003420747.1.46117 WP_003420747.1.46274 WP_003420747.1.46280 WP_003420747.1.46305 WP_003420747.1.46522 WP_003420747.1.4698 WP_003420747.1.47016 WP_003420747.1.47121 WP_003420747.1.47173 WP_003420747.1.47227 WP_003420747.1.47228 WP_003420747.1.47479 WP_003420747.1.47615 WP_003420747.1.47708 WP_003420747.1.47729 WP_003420747.1.47940 WP_003420747.1.48220 WP_003420747.1.48246 WP_003420747.1.48279 WP_003420747.1.4835 WP_003420747.1.48491 WP_003420747.1.48746 WP_003420747.1.48772 WP_003420747.1.48935 WP_003420747.1.48980 WP_003420747.1.48983 WP_003420747.1.48991 WP_003420747.1.49020 WP_003420747.1.49054 WP_003420747.1.49065 WP_003420747.1.4908 WP_003420747.1.49092 WP_003420747.1.49230 WP_003420747.1.49310 WP_003420747.1.49339 WP_003420747.1.49451 WP_003420747.1.4948 WP_003420747.1.49633 WP_003420747.1.50159 WP_003420747.1.50341 WP_003420747.1.50460 WP_003420747.1.50495 WP_003420747.1.5073 WP_003420747.1.50865 WP_003420747.1.51007 WP_003420747.1.51166 WP_003420747.1.51235 WP_003420747.1.51675 WP_003420747.1.5187 WP_003420747.1.51996 WP_003420747.1.52073 WP_003420747.1.52164 WP_003420747.1.52266 WP_003420747.1.52278 WP_003420747.1.52294 WP_003420747.1.52311 WP_003420747.1.52330 WP_003420747.1.52383 WP_003420747.1.52402 WP_003420747.1.52466 WP_003420747.1.52525 WP_003420747.1.52789 WP_003420747.1.52958 WP_003420747.1.52997 WP_003420747.1.53008 WP_003420747.1.53044 WP_003420747.1.53055 WP_003420747.1.53288 WP_003420747.1.5337 WP_003420747.1.53504 WP_003420747.1.53704 WP_003420747.1.53710 WP_003420747.1.53729 WP_003420747.1.53987 WP_003420747.1.54058 WP_003420747.1.54153 WP_003420747.1.5423 WP_003420747.1.54262 WP_003420747.1.54350 WP_003420747.1.54586 WP_003420747.1.54593 WP_003420747.1.54692 WP_003420747.1.55055 WP_003420747.1.55101 WP_003420747.1.5521 WP_003420747.1.55302 WP_003420747.1.55371 WP_003420747.1.55391 WP_003420747.1.5558 WP_003420747.1.559 WP_003420747.1.56006 WP_003420747.1.56217 WP_003420747.1.56252 WP_003420747.1.56323 WP_003420747.1.56337 WP_003420747.1.56556 WP_003420747.1.5657 WP_003420747.1.5661 WP_003420747.1.5664 WP_003420747.1.56664 WP_003420747.1.56711 WP_003420747.1.56754 WP_003420747.1.56927 WP_003420747.1.56998 WP_003420747.1.57099 WP_003420747.1.57337 WP_003420747.1.5750 WP_003420747.1.57711 WP_003420747.1.57827 WP_003420747.1.58015 WP_003420747.1.58216 WP_003420747.1.58304 WP_003420747.1.58315 WP_003420747.1.58323 WP_003420747.1.58463 WP_003420747.1.58531 WP_003420747.1.58665 WP_003420747.1.58677 WP_003420747.1.58711 WP_003420747.1.58818 WP_003420747.1.59032 WP_003420747.1.5905 WP_003420747.1.59588 WP_003420747.1.59618 WP_003420747.1.59628 WP_003420747.1.59707 WP_003420747.1.59752 WP_003420747.1.59990 WP_003420747.1.60040 WP_003420747.1.6031 WP_003420747.1.60482 WP_003420747.1.60563 WP_003420747.1.6070 WP_003420747.1.60957 WP_003420747.1.60998 WP_003420747.1.61042 WP_003420747.1.61140 WP_003420747.1.61293 WP_003420747.1.61492 WP_003420747.1.61679 WP_003420747.1.61716 WP_003420747.1.61866 WP_003420747.1.61972 WP_003420747.1.62049 WP_003420747.1.62095 WP_003420747.1.62128 WP_003420747.1.62340 WP_003420747.1.62577 WP_003420747.1.62624 WP_003420747.1.62637 WP_003420747.1.62797 WP_003420747.1.62941 WP_003420747.1.62986 WP_003420747.1.63020 WP_003420747.1.63059 WP_003420747.1.63237 WP_003420747.1.63239 WP_003420747.1.63248 WP_003420747.1.63343 WP_003420747.1.63378 WP_003420747.1.63516 WP_003420747.1.63570 WP_003420747.1.63581 WP_003420747.1.63598 WP_003420747.1.63599 WP_003420747.1.63696 WP_003420747.1.63804 WP_003420747.1.63852 WP_003420747.1.63853 WP_003420747.1.63950 WP_003420747.1.64020 WP_003420747.1.64092 WP_003420747.1.64197 WP_003420747.1.64369 WP_003420747.1.64447 WP_003420747.1.64546 WP_003420747.1.64573 WP_003420747.1.64859 WP_003420747.1.65064 WP_003420747.1.65067 WP_003420747.1.65313 WP_003420747.1.65369 WP_003420747.1.65889 WP_003420747.1.66084 WP_003420747.1.66119 WP_003420747.1.66237 WP_003420747.1.66439 WP_003420747.1.66474 WP_003420747.1.66565 WP_003420747.1.66587 WP_003420747.1.66608 WP_003420747.1.66643 WP_003420747.1.66701 WP_003420747.1.6671 WP_003420747.1.6675 WP_003420747.1.66805 WP_003420747.1.66847 WP_003420747.1.6685 WP_003420747.1.66887 WP_003420747.1.66888 WP_003420747.1.66900 WP_003420747.1.670 WP_003420747.1.67303 WP_003420747.1.67308 WP_003420747.1.6736 WP_003420747.1.67368 WP_003420747.1.67528 WP_003420747.1.67689 WP_003420747.1.67695 WP_003420747.1.67711 WP_003420747.1.6792 WP_003420747.1.67951 WP_003420747.1.68150 WP_003420747.1.68276 WP_003420747.1.68322 WP_003420747.1.68955 WP_003420747.1.6898 WP_003420747.1.68980 WP_003420747.1.69114 WP_003420747.1.692 WP_003420747.1.69220 WP_003420747.1.69333 WP_003420747.1.69495 WP_003420747.1.69708 WP_003420747.1.6994 WP_003420747.1.700 WP_003420747.1.70152 WP_003420747.1.70179 WP_003420747.1.70231 WP_003420747.1.70320 WP_003420747.1.70464 WP_003420747.1.70695 WP_003420747.1.70710 WP_003420747.1.70820 WP_003420747.1.70886 WP_003420747.1.71079 WP_003420747.1.71119 WP_003420747.1.713 WP_003420747.1.71384 WP_003420747.1.71477 WP_003420747.1.7156 WP_003420747.1.71745 WP_003420747.1.7199 WP_003420747.1.72113 WP_003420747.1.72245 WP_003420747.1.72468 WP_003420747.1.72483 WP_003420747.1.72560 WP_003420747.1.72681 WP_003420747.1.72682 WP_003420747.1.72891 WP_003420747.1.72909 WP_003420747.1.72914 WP_003420747.1.72994 WP_003420747.1.73026 WP_003420747.1.73116 WP_003420747.1.7322 WP_003420747.1.73605 WP_003420747.1.73852 WP_003420747.1.73931 WP_003420747.1.74050 WP_003420747.1.74116 WP_003420747.1.74126 WP_003420747.1.74672 WP_003420747.1.74678 WP_003420747.1.74680 WP_003420747.1.74779 WP_003420747.1.74835 WP_003420747.1.74897 WP_003420747.1.75026 WP_003420747.1.751 WP_003420747.1.75210 WP_003420747.1.75226 WP_003420747.1.75287 WP_003420747.1.75454 WP_003420747.1.75638 WP_003420747.1.75659 WP_003420747.1.76207 WP_003420747.1.7650 WP_003420747.1.76550 WP_003420747.1.76552 WP_003420747.1.76603 WP_003420747.1.76621 WP_003420747.1.76664 WP_003420747.1.76687 WP_003420747.1.76793 WP_003420747.1.76813 WP_003420747.1.76882 WP_003420747.1.76924 WP_003420747.1.7696 WP_003420747.1.77092 WP_003420747.1.77102 WP_003420747.1.77473 WP_003420747.1.77509 WP_003420747.1.77544 WP_003420747.1.7755 WP_003420747.1.77639 WP_003420747.1.77782 WP_003420747.1.77842 WP_003420747.1.77942 WP_003420747.1.78123 WP_003420747.1.78579 WP_003420747.1.78949 WP_003420747.1.79125 WP_003420747.1.7916 WP_003420747.1.79199 WP_003420747.1.79221 WP_003420747.1.79309 WP_003420747.1.79344 WP_003420747.1.79437 WP_003420747.1.79611 WP_003420747.1.79673 WP_003420747.1.79680 WP_003420747.1.79703 WP_003420747.1.79836 WP_003420747.1.79956 WP_003420747.1.80052 WP_003420747.1.80144 WP_003420747.1.80342 WP_003420747.1.80379 WP_003420747.1.80455 WP_003420747.1.80504 WP_003420747.1.80575 WP_003420747.1.80610 WP_003420747.1.80963 WP_003420747.1.81035 WP_003420747.1.81044 WP_003420747.1.81208 WP_003420747.1.81299 WP_003420747.1.81351 WP_003420747.1.81402 WP_003420747.1.81605 WP_003420747.1.81777 WP_003420747.1.82002 WP_003420747.1.82084 WP_003420747.1.82150 WP_003420747.1.82169 WP_003420747.1.82335 WP_003420747.1.82635 WP_003420747.1.82701 WP_003420747.1.82920 WP_003420747.1.8314 WP_003420747.1.83148 WP_003420747.1.83175 WP_003420747.1.83255 WP_003420747.1.83287 WP_003420747.1.83288 WP_003420747.1.83318 WP_003420747.1.83348 WP_003420747.1.834 WP_003420747.1.83477 WP_003420747.1.83515 WP_003420747.1.83641 WP_003420747.1.83822 WP_003420747.1.83918 WP_003420747.1.84195 WP_003420747.1.84253 WP_003420747.1.84528 WP_003420747.1.84606 WP_003420747.1.84646 WP_003420747.1.84843 WP_003420747.1.84880 WP_003420747.1.84923 WP_003420747.1.85020 WP_003420747.1.85127 WP_003420747.1.85214 WP_003420747.1.85219 WP_003420747.1.8527 WP_003420747.1.85420 WP_003420747.1.85442 WP_003420747.1.85454 WP_003420747.1.85776 WP_003420747.1.85863 WP_003420747.1.8587 WP_003420747.1.85874 WP_003420747.1.85932 WP_003420747.1.86008 WP_003420747.1.86011 WP_003420747.1.86049 WP_003420747.1.86088 WP_003420747.1.86094 WP_003420747.1.86116 WP_003420747.1.86117 WP_003420747.1.86328 WP_003420747.1.86395 WP_003420747.1.86534 WP_003420747.1.86618 WP_003420747.1.86743 WP_003420747.1.86767 WP_003420747.1.86837 WP_003420747.1.86914 WP_003420747.1.87058 WP_003420747.1.87195 WP_003420747.1.87326 WP_003420747.1.87454 WP_003420747.1.87714 WP_003420747.1.87723 WP_003420747.1.87730 WP_003420747.1.87918 WP_003420747.1.87932 WP_003420747.1.88091 WP_003420747.1.882 WP_003420747.1.88268 WP_003420747.1.88332 WP_003420747.1.88364 WP_003420747.1.88372 WP_003420747.1.88377 WP_003420747.1.88608 WP_003420747.1.88640 WP_003420747.1.88996 WP_003420747.1.89052 WP_003420747.1.89065 WP_003420747.1.89196 WP_003420747.1.89337 WP_003420747.1.89364 WP_003420747.1.89457 WP_003420747.1.89541 WP_003420747.1.89629 WP_003420747.1.89697 WP_003420747.1.89994 WP_003420747.1.90076 WP_003420747.1.90101 WP_003420747.1.90164 WP_003420747.1.90329 WP_003420747.1.9041 WP_003420747.1.90491 WP_003420747.1.90555 WP_003420747.1.90643 WP_003420747.1.9083 WP_003420747.1.90921 WP_003420747.1.90938 WP_003420747.1.90981 WP_003420747.1.90985 WP_003420747.1.91065 WP_003420747.1.91254 WP_003420747.1.91314 WP_003420747.1.91406 WP_003420747.1.91570 WP_003420747.1.91648 WP_003420747.1.92075 WP_003420747.1.92284 WP_003420747.1.92371 WP_003420747.1.92576 WP_003420747.1.92658 WP_003420747.1.92697 WP_003420747.1.92941 WP_003420747.1.93044 WP_003420747.1.93171 WP_003420747.1.93313 WP_003420747.1.93360 WP_003420747.1.93480 WP_003420747.1.93615 WP_003420747.1.93687 WP_003420747.1.93717 WP_003420747.1.93766 WP_003420747.1.93782 WP_003420747.1.93798 WP_003420747.1.93802 WP_003420747.1.93830 WP_003420747.1.9393 WP_003420747.1.94067 WP_003420747.1.94073 WP_003420747.1.94166 WP_003420747.1.94427 WP_003420747.1.94768 WP_003420747.1.94831 WP_003420747.1.94968 WP_003420747.1.95095 WP_003420747.1.95173 WP_003420747.1.9522 WP_003420747.1.95350 WP_003420747.1.95517 WP_003420747.1.9580 WP_003420747.1.95847 WP_003420747.1.95893 WP_003420747.1.96113 WP_003420747.1.96503 WP_003420747.1.96505 WP_003420747.1.9666 WP_003420747.1.96690 WP_003420747.1.96765 WP_003420747.1.97219 WP_003420747.1.97432 WP_003420747.1.97458 WP_003420747.1.97672 WP_003420747.1.97682 WP_003420747.1.97806 WP_003420747.1.98037 WP_003420747.1.98514 WP_003420747.1.98622 WP_003420747.1.98698 WP_003420747.1.98715 WP_003420747.1.98748 WP_003420747.1.98856 WP_003420747.1.98913 WP_003420747.1.98997 WP_003420747.1.99064 WP_003420747.1.99134 WP_003420747.1.99333 WP_003420747.1.99542 WP_003420747.1.99545 WP_003420747.1.99731 WP_003420747.1.9986 YP_001086604.1.32744 gi|260685511|ref|YP_003216644.1| 272563.CD0135 645462.CD196_0147 645463.CDR20291_0134 gi|260681913|ref|YP_003213198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]