SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126698121|ref|YP_001087018.1| from Clostridium difficile 630

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126698121|ref|YP_001087018.1|
Domain Number 1 Region: 7-191
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.54e-64
Family Methylesterase CheB, C-terminal domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126698121|ref|YP_001087018.1|
Sequence length 198
Comment protein-glutamate methylesterase [Clostridium difficile 630]
Sequence
MERFNNMVIAIGASVGGTEAILEIIKDLPKSTPGIVVVQHMPAIFTYMYAQRLDKQCIMN
VREAKNNDRVEQGNVLIAPGGYQMKLCTDKQGYYVTCEKGERISGHCPSVDVLFDSVAEV
AGKNSIGIILTGMGYDGANGLLKMKENGSFTIGQDENSCIVYGMPMVAFDRGSVMLQLPL
GEISNCLIRHINILKQKD
Download sequence
Identical sequences A0A031WD73 Q188Y9
WP_011860852.1.100055 WP_011860852.1.100107 WP_011860852.1.100118 WP_011860852.1.100570 WP_011860852.1.100660 WP_011860852.1.100831 WP_011860852.1.100923 WP_011860852.1.102031 WP_011860852.1.102074 WP_011860852.1.102095 WP_011860852.1.10483 WP_011860852.1.10582 WP_011860852.1.10691 WP_011860852.1.10793 WP_011860852.1.11320 WP_011860852.1.1167 WP_011860852.1.11937 WP_011860852.1.11954 WP_011860852.1.11959 WP_011860852.1.12066 WP_011860852.1.1254 WP_011860852.1.12659 WP_011860852.1.12953 WP_011860852.1.13273 WP_011860852.1.13730 WP_011860852.1.13841 WP_011860852.1.14177 WP_011860852.1.14259 WP_011860852.1.14352 WP_011860852.1.14579 WP_011860852.1.14686 WP_011860852.1.14698 WP_011860852.1.1494 WP_011860852.1.15083 WP_011860852.1.15192 WP_011860852.1.169 WP_011860852.1.17512 WP_011860852.1.17611 WP_011860852.1.17638 WP_011860852.1.18060 WP_011860852.1.18407 WP_011860852.1.18551 WP_011860852.1.1926 WP_011860852.1.19290 WP_011860852.1.19956 WP_011860852.1.20184 WP_011860852.1.20302 WP_011860852.1.20313 WP_011860852.1.20872 WP_011860852.1.20960 WP_011860852.1.21000 WP_011860852.1.21048 WP_011860852.1.21520 WP_011860852.1.21547 WP_011860852.1.22079 WP_011860852.1.22128 WP_011860852.1.22228 WP_011860852.1.22417 WP_011860852.1.22568 WP_011860852.1.22569 WP_011860852.1.22615 WP_011860852.1.22768 WP_011860852.1.22893 WP_011860852.1.23096 WP_011860852.1.23208 WP_011860852.1.23287 WP_011860852.1.24197 WP_011860852.1.24987 WP_011860852.1.26024 WP_011860852.1.26482 WP_011860852.1.26494 WP_011860852.1.26940 WP_011860852.1.2758 WP_011860852.1.27708 WP_011860852.1.27881 WP_011860852.1.27890 WP_011860852.1.27996 WP_011860852.1.28410 WP_011860852.1.28856 WP_011860852.1.28890 WP_011860852.1.29600 WP_011860852.1.29891 WP_011860852.1.30420 WP_011860852.1.30463 WP_011860852.1.30521 WP_011860852.1.30743 WP_011860852.1.30841 WP_011860852.1.30953 WP_011860852.1.31292 WP_011860852.1.31477 WP_011860852.1.32066 WP_011860852.1.32294 WP_011860852.1.32776 WP_011860852.1.32842 WP_011860852.1.33098 WP_011860852.1.33349 WP_011860852.1.34388 WP_011860852.1.34489 WP_011860852.1.34641 WP_011860852.1.35137 WP_011860852.1.35234 WP_011860852.1.35884 WP_011860852.1.36738 WP_011860852.1.374 WP_011860852.1.37532 WP_011860852.1.37597 WP_011860852.1.37957 WP_011860852.1.38338 WP_011860852.1.38692 WP_011860852.1.38874 WP_011860852.1.38924 WP_011860852.1.3913 WP_011860852.1.39382 WP_011860852.1.39442 WP_011860852.1.39874 WP_011860852.1.40030 WP_011860852.1.40313 WP_011860852.1.40447 WP_011860852.1.40557 WP_011860852.1.407 WP_011860852.1.40891 WP_011860852.1.40959 WP_011860852.1.40966 WP_011860852.1.4121 WP_011860852.1.41334 WP_011860852.1.4137 WP_011860852.1.41641 WP_011860852.1.41818 WP_011860852.1.41995 WP_011860852.1.4204 WP_011860852.1.42610 WP_011860852.1.43112 WP_011860852.1.4315 WP_011860852.1.43388 WP_011860852.1.43490 WP_011860852.1.4383 WP_011860852.1.44030 WP_011860852.1.44105 WP_011860852.1.44149 WP_011860852.1.45017 WP_011860852.1.45209 WP_011860852.1.45352 WP_011860852.1.45554 WP_011860852.1.4573 WP_011860852.1.46280 WP_011860852.1.47173 WP_011860852.1.47708 WP_011860852.1.47729 WP_011860852.1.4835 WP_011860852.1.48746 WP_011860852.1.49054 WP_011860852.1.49230 WP_011860852.1.4948 WP_011860852.1.49633 WP_011860852.1.50159 WP_011860852.1.50341 WP_011860852.1.50460 WP_011860852.1.5073 WP_011860852.1.50865 WP_011860852.1.51007 WP_011860852.1.5187 WP_011860852.1.53055 WP_011860852.1.54058 WP_011860852.1.54153 WP_011860852.1.5521 WP_011860852.1.56006 WP_011860852.1.56252 WP_011860852.1.56556 WP_011860852.1.5657 WP_011860852.1.5664 WP_011860852.1.56927 WP_011860852.1.5750 WP_011860852.1.58216 WP_011860852.1.58304 WP_011860852.1.58463 WP_011860852.1.58677 WP_011860852.1.59032 WP_011860852.1.5905 WP_011860852.1.59628 WP_011860852.1.59752 WP_011860852.1.59990 WP_011860852.1.60482 WP_011860852.1.6070 WP_011860852.1.61140 WP_011860852.1.61293 WP_011860852.1.61716 WP_011860852.1.62624 WP_011860852.1.62941 WP_011860852.1.63059 WP_011860852.1.63343 WP_011860852.1.63598 WP_011860852.1.64092 WP_011860852.1.64546 WP_011860852.1.65067 WP_011860852.1.65369 WP_011860852.1.65889 WP_011860852.1.66237 WP_011860852.1.66587 WP_011860852.1.66643 WP_011860852.1.66847 WP_011860852.1.66887 WP_011860852.1.67368 WP_011860852.1.67689 WP_011860852.1.6792 WP_011860852.1.69114 WP_011860852.1.692 WP_011860852.1.69708 WP_011860852.1.6994 WP_011860852.1.70320 WP_011860852.1.71079 WP_011860852.1.713 WP_011860852.1.71384 WP_011860852.1.7199 WP_011860852.1.72245 WP_011860852.1.72468 WP_011860852.1.72483 WP_011860852.1.72681 WP_011860852.1.72914 WP_011860852.1.73026 WP_011860852.1.73116 WP_011860852.1.74835 WP_011860852.1.74897 WP_011860852.1.75026 WP_011860852.1.75210 WP_011860852.1.75454 WP_011860852.1.75638 WP_011860852.1.76207 WP_011860852.1.76550 WP_011860852.1.76603 WP_011860852.1.76664 WP_011860852.1.76882 WP_011860852.1.7696 WP_011860852.1.77102 WP_011860852.1.77473 WP_011860852.1.77544 WP_011860852.1.77639 WP_011860852.1.77942 WP_011860852.1.78123 WP_011860852.1.78579 WP_011860852.1.7916 WP_011860852.1.79221 WP_011860852.1.79344 WP_011860852.1.79703 WP_011860852.1.79836 WP_011860852.1.80379 WP_011860852.1.80455 WP_011860852.1.81035 WP_011860852.1.81044 WP_011860852.1.81402 WP_011860852.1.81605 WP_011860852.1.82084 WP_011860852.1.82635 WP_011860852.1.83148 WP_011860852.1.83175 WP_011860852.1.83255 WP_011860852.1.83287 WP_011860852.1.83348 WP_011860852.1.834 WP_011860852.1.84923 WP_011860852.1.85127 WP_011860852.1.85219 WP_011860852.1.85454 WP_011860852.1.85874 WP_011860852.1.86008 WP_011860852.1.86088 WP_011860852.1.86094 WP_011860852.1.86117 WP_011860852.1.86914 WP_011860852.1.87326 WP_011860852.1.87714 WP_011860852.1.87918 WP_011860852.1.88091 WP_011860852.1.882 WP_011860852.1.88332 WP_011860852.1.88608 WP_011860852.1.89052 WP_011860852.1.89065 WP_011860852.1.89196 WP_011860852.1.89457 WP_011860852.1.89697 WP_011860852.1.90101 WP_011860852.1.90491 WP_011860852.1.90555 WP_011860852.1.90643 WP_011860852.1.9083 WP_011860852.1.90938 WP_011860852.1.90981 WP_011860852.1.91648 WP_011860852.1.92075 WP_011860852.1.93044 WP_011860852.1.93171 WP_011860852.1.93615 WP_011860852.1.93687 WP_011860852.1.93717 WP_011860852.1.93798 WP_011860852.1.93830 WP_011860852.1.94073 WP_011860852.1.94166 WP_011860852.1.94427 WP_011860852.1.94968 WP_011860852.1.95350 WP_011860852.1.9580 WP_011860852.1.95847 WP_011860852.1.95893 WP_011860852.1.96113 WP_011860852.1.9635 WP_011860852.1.96503 WP_011860852.1.9666 WP_011860852.1.96690 WP_011860852.1.97219 WP_011860852.1.97458 WP_011860852.1.98715 WP_011860852.1.98856 WP_011860852.1.98997 WP_011860852.1.99134 WP_011860852.1.99333 WP_011860852.1.9986 YP_001087018.1.32744 gi|126698121|ref|YP_001087018.1| 272563.CD0542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]