SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126698302|ref|YP_001087199.1| from Clostridium difficile 630

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126698302|ref|YP_001087199.1|
Domain Number 1 Region: 1-292
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.33e-68
Family Methylenetetrahydrofolate reductase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126698302|ref|YP_001087199.1|
Sequence length 293
Comment 5,10-methylenetetrahydrofolate reductase [Clostridium difficile 630]
Sequence
MSLLRETLESGKFAVTTEMAPPKGTDLSHLIECAKPLVGRVHAANVTDFQSAVMRATSLA
TCKLLKDAGLEPVIQITGRDRNRIAIQGEMLSAGVFGINNLLALTGDHTSVGDHPQAKGV
FDLDSVGILQTAETLMAGTDMAGNKLKGSPDFYLGASVTPEYSPIEVQLLKMKKKIKAGA
KFFQTQALYDINTMRKFRELTRDMDCKVLAGIVPLKSPGMAKFMTANVPGIFVPDEQIER
LRAAGKENWVSEGIKMAGELIKQLKEEDLCDGVHIMAIGAEENIPAILDAAGL
Download sequence
Identical sequences A0A031WFI8 A0A0J0UG55 A0A125V3H2 Q189R6 T4I771
WP_003436920.1.100055 WP_003436920.1.100107 WP_003436920.1.100118 WP_003436920.1.100513 WP_003436920.1.100570 WP_003436920.1.100660 WP_003436920.1.100831 WP_003436920.1.101035 WP_003436920.1.101125 WP_003436920.1.101316 WP_003436920.1.101532 WP_003436920.1.101861 WP_003436920.1.102031 WP_003436920.1.102074 WP_003436920.1.102095 WP_003436920.1.10483 WP_003436920.1.10582 WP_003436920.1.10793 WP_003436920.1.10795 WP_003436920.1.11224 WP_003436920.1.11278 WP_003436920.1.11320 WP_003436920.1.11398 WP_003436920.1.1167 WP_003436920.1.1179 WP_003436920.1.11937 WP_003436920.1.11959 WP_003436920.1.12385 WP_003436920.1.1254 WP_003436920.1.12629 WP_003436920.1.12632 WP_003436920.1.12659 WP_003436920.1.12734 WP_003436920.1.12807 WP_003436920.1.13273 WP_003436920.1.13418 WP_003436920.1.13730 WP_003436920.1.13841 WP_003436920.1.13859 WP_003436920.1.14045 WP_003436920.1.141 WP_003436920.1.14177 WP_003436920.1.1422 WP_003436920.1.14259 WP_003436920.1.14330 WP_003436920.1.14352 WP_003436920.1.14579 WP_003436920.1.14698 WP_003436920.1.14848 WP_003436920.1.1494 WP_003436920.1.15083 WP_003436920.1.15097 WP_003436920.1.15192 WP_003436920.1.15205 WP_003436920.1.15908 WP_003436920.1.16012 WP_003436920.1.16135 WP_003436920.1.16185 WP_003436920.1.16376 WP_003436920.1.169 WP_003436920.1.16966 WP_003436920.1.17371 WP_003436920.1.17413 WP_003436920.1.17463 WP_003436920.1.17512 WP_003436920.1.17611 WP_003436920.1.17808 WP_003436920.1.17960 WP_003436920.1.18060 WP_003436920.1.18207 WP_003436920.1.1838 WP_003436920.1.18407 WP_003436920.1.18462 WP_003436920.1.18551 WP_003436920.1.19088 WP_003436920.1.1926 WP_003436920.1.19290 WP_003436920.1.1934 WP_003436920.1.19648 WP_003436920.1.19704 WP_003436920.1.19956 WP_003436920.1.1999 WP_003436920.1.2002 WP_003436920.1.20132 WP_003436920.1.20184 WP_003436920.1.20302 WP_003436920.1.20313 WP_003436920.1.20481 WP_003436920.1.20728 WP_003436920.1.20872 WP_003436920.1.20960 WP_003436920.1.21000 WP_003436920.1.21048 WP_003436920.1.21201 WP_003436920.1.21520 WP_003436920.1.21547 WP_003436920.1.21704 WP_003436920.1.21893 WP_003436920.1.22228 WP_003436920.1.22313 WP_003436920.1.22417 WP_003436920.1.22568 WP_003436920.1.22569 WP_003436920.1.22615 WP_003436920.1.22768 WP_003436920.1.22893 WP_003436920.1.23096 WP_003436920.1.23208 WP_003436920.1.23287 WP_003436920.1.24197 WP_003436920.1.24457 WP_003436920.1.24520 WP_003436920.1.24889 WP_003436920.1.24900 WP_003436920.1.24987 WP_003436920.1.25128 WP_003436920.1.25416 WP_003436920.1.25761 WP_003436920.1.26024 WP_003436920.1.26358 WP_003436920.1.26482 WP_003436920.1.26494 WP_003436920.1.26697 WP_003436920.1.26940 WP_003436920.1.27708 WP_003436920.1.27824 WP_003436920.1.27872 WP_003436920.1.27881 WP_003436920.1.27890 WP_003436920.1.27967 WP_003436920.1.27996 WP_003436920.1.28055 WP_003436920.1.28410 WP_003436920.1.28715 WP_003436920.1.28856 WP_003436920.1.28882 WP_003436920.1.28890 WP_003436920.1.28930 WP_003436920.1.293 WP_003436920.1.29600 WP_003436920.1.29891 WP_003436920.1.3024 WP_003436920.1.3031 WP_003436920.1.30420 WP_003436920.1.30431 WP_003436920.1.30463 WP_003436920.1.30743 WP_003436920.1.30841 WP_003436920.1.30953 WP_003436920.1.31292 WP_003436920.1.31309 WP_003436920.1.31453 WP_003436920.1.31477 WP_003436920.1.31519 WP_003436920.1.31719 WP_003436920.1.32066 WP_003436920.1.32166 WP_003436920.1.32197 WP_003436920.1.32218 WP_003436920.1.32294 WP_003436920.1.32769 WP_003436920.1.32776 WP_003436920.1.32842 WP_003436920.1.33056 WP_003436920.1.33098 WP_003436920.1.33164 WP_003436920.1.33298 WP_003436920.1.33332 WP_003436920.1.33349 WP_003436920.1.3340 WP_003436920.1.33514 WP_003436920.1.33810 WP_003436920.1.34388 WP_003436920.1.34489 WP_003436920.1.34545 WP_003436920.1.34641 WP_003436920.1.34800 WP_003436920.1.34985 WP_003436920.1.35 WP_003436920.1.35002 WP_003436920.1.35137 WP_003436920.1.35187 WP_003436920.1.35234 WP_003436920.1.3559 WP_003436920.1.35832 WP_003436920.1.35884 WP_003436920.1.36078 WP_003436920.1.36257 WP_003436920.1.36738 WP_003436920.1.36835 WP_003436920.1.37255 WP_003436920.1.374 WP_003436920.1.37532 WP_003436920.1.37597 WP_003436920.1.3789 WP_003436920.1.37957 WP_003436920.1.37981 WP_003436920.1.38338 WP_003436920.1.38692 WP_003436920.1.38775 WP_003436920.1.38874 WP_003436920.1.38924 WP_003436920.1.38986 WP_003436920.1.3913 WP_003436920.1.39213 WP_003436920.1.39350 WP_003436920.1.39382 WP_003436920.1.39442 WP_003436920.1.39783 WP_003436920.1.39874 WP_003436920.1.40030 WP_003436920.1.40294 WP_003436920.1.40313 WP_003436920.1.40447 WP_003436920.1.40557 WP_003436920.1.407 WP_003436920.1.40775 WP_003436920.1.40891 WP_003436920.1.40959 WP_003436920.1.40966 WP_003436920.1.41131 WP_003436920.1.4121 WP_003436920.1.41334 WP_003436920.1.4137 WP_003436920.1.41506 WP_003436920.1.41641 WP_003436920.1.41687 WP_003436920.1.41818 WP_003436920.1.41995 WP_003436920.1.42035 WP_003436920.1.42066 WP_003436920.1.42533 WP_003436920.1.42610 WP_003436920.1.43112 WP_003436920.1.4315 WP_003436920.1.4321 WP_003436920.1.43388 WP_003436920.1.43490 WP_003436920.1.43519 WP_003436920.1.43579 WP_003436920.1.43824 WP_003436920.1.4383 WP_003436920.1.44030 WP_003436920.1.44105 WP_003436920.1.44149 WP_003436920.1.44198 WP_003436920.1.44241 WP_003436920.1.44470 WP_003436920.1.44729 WP_003436920.1.45017 WP_003436920.1.45059 WP_003436920.1.45352 WP_003436920.1.45554 WP_003436920.1.4573 WP_003436920.1.45938 WP_003436920.1.45986 WP_003436920.1.46274 WP_003436920.1.46280 WP_003436920.1.46305 WP_003436920.1.4698 WP_003436920.1.47016 WP_003436920.1.47227 WP_003436920.1.47228 WP_003436920.1.47615 WP_003436920.1.47708 WP_003436920.1.47729 WP_003436920.1.47940 WP_003436920.1.48246 WP_003436920.1.4835 WP_003436920.1.48746 WP_003436920.1.48772 WP_003436920.1.48980 WP_003436920.1.48983 WP_003436920.1.48991 WP_003436920.1.49020 WP_003436920.1.49054 WP_003436920.1.4908 WP_003436920.1.49092 WP_003436920.1.49310 WP_003436920.1.4948 WP_003436920.1.49633 WP_003436920.1.50159 WP_003436920.1.50341 WP_003436920.1.5073 WP_003436920.1.50865 WP_003436920.1.51007 WP_003436920.1.51235 WP_003436920.1.51996 WP_003436920.1.52073 WP_003436920.1.52266 WP_003436920.1.52278 WP_003436920.1.52330 WP_003436920.1.52383 WP_003436920.1.52402 WP_003436920.1.52466 WP_003436920.1.52525 WP_003436920.1.52789 WP_003436920.1.52997 WP_003436920.1.53055 WP_003436920.1.5337 WP_003436920.1.53504 WP_003436920.1.54058 WP_003436920.1.54153 WP_003436920.1.54350 WP_003436920.1.54586 WP_003436920.1.55055 WP_003436920.1.55101 WP_003436920.1.5521 WP_003436920.1.55302 WP_003436920.1.55371 WP_003436920.1.55391 WP_003436920.1.5558 WP_003436920.1.559 WP_003436920.1.56006 WP_003436920.1.56252 WP_003436920.1.56323 WP_003436920.1.56337 WP_003436920.1.56556 WP_003436920.1.5657 WP_003436920.1.5664 WP_003436920.1.56664 WP_003436920.1.56754 WP_003436920.1.56927 WP_003436920.1.56998 WP_003436920.1.57337 WP_003436920.1.5750 WP_003436920.1.58015 WP_003436920.1.58216 WP_003436920.1.58304 WP_003436920.1.58315 WP_003436920.1.58463 WP_003436920.1.58665 WP_003436920.1.58677 WP_003436920.1.58711 WP_003436920.1.58818 WP_003436920.1.58956 WP_003436920.1.59032 WP_003436920.1.5905 WP_003436920.1.59618 WP_003436920.1.59628 WP_003436920.1.59752 WP_003436920.1.6031 WP_003436920.1.60482 WP_003436920.1.6070 WP_003436920.1.60957 WP_003436920.1.60998 WP_003436920.1.61140 WP_003436920.1.61293 WP_003436920.1.61716 WP_003436920.1.61866 WP_003436920.1.62049 WP_003436920.1.62095 WP_003436920.1.62128 WP_003436920.1.62340 WP_003436920.1.62624 WP_003436920.1.62941 WP_003436920.1.62986 WP_003436920.1.63020 WP_003436920.1.63059 WP_003436920.1.63239 WP_003436920.1.63343 WP_003436920.1.63378 WP_003436920.1.63516 WP_003436920.1.63598 WP_003436920.1.63696 WP_003436920.1.64020 WP_003436920.1.64092 WP_003436920.1.64369 WP_003436920.1.64546 WP_003436920.1.64573 WP_003436920.1.64859 WP_003436920.1.65064 WP_003436920.1.65067 WP_003436920.1.65369 WP_003436920.1.65889 WP_003436920.1.66084 WP_003436920.1.66237 WP_003436920.1.66474 WP_003436920.1.66565 WP_003436920.1.66587 WP_003436920.1.66608 WP_003436920.1.66643 WP_003436920.1.66701 WP_003436920.1.6671 WP_003436920.1.66805 WP_003436920.1.66847 WP_003436920.1.6685 WP_003436920.1.66887 WP_003436920.1.67303 WP_003436920.1.67308 WP_003436920.1.67368 WP_003436920.1.67689 WP_003436920.1.67711 WP_003436920.1.6792 WP_003436920.1.68150 WP_003436920.1.68322 WP_003436920.1.68980 WP_003436920.1.69114 WP_003436920.1.692 WP_003436920.1.69220 WP_003436920.1.69333 WP_003436920.1.69708 WP_003436920.1.6994 WP_003436920.1.70179 WP_003436920.1.70231 WP_003436920.1.70320 WP_003436920.1.70695 WP_003436920.1.70710 WP_003436920.1.70820 WP_003436920.1.70886 WP_003436920.1.71079 WP_003436920.1.71119 WP_003436920.1.713 WP_003436920.1.71384 WP_003436920.1.71477 WP_003436920.1.7156 WP_003436920.1.7199 WP_003436920.1.72113 WP_003436920.1.72245 WP_003436920.1.72468 WP_003436920.1.72483 WP_003436920.1.72560 WP_003436920.1.72891 WP_003436920.1.72914 WP_003436920.1.72994 WP_003436920.1.73026 WP_003436920.1.73116 WP_003436920.1.73852 WP_003436920.1.74672 WP_003436920.1.74835 WP_003436920.1.74897 WP_003436920.1.75026 WP_003436920.1.75210 WP_003436920.1.75226 WP_003436920.1.75287 WP_003436920.1.75454 WP_003436920.1.75638 WP_003436920.1.75659 WP_003436920.1.76207 WP_003436920.1.76550 WP_003436920.1.76552 WP_003436920.1.76603 WP_003436920.1.76621 WP_003436920.1.76664 WP_003436920.1.76793 WP_003436920.1.76882 WP_003436920.1.76924 WP_003436920.1.7696 WP_003436920.1.77092 WP_003436920.1.77102 WP_003436920.1.77473 WP_003436920.1.77509 WP_003436920.1.77544 WP_003436920.1.77639 WP_003436920.1.77842 WP_003436920.1.77942 WP_003436920.1.78123 WP_003436920.1.78579 WP_003436920.1.78949 WP_003436920.1.7916 WP_003436920.1.79221 WP_003436920.1.79309 WP_003436920.1.79344 WP_003436920.1.79437 WP_003436920.1.79680 WP_003436920.1.79703 WP_003436920.1.79836 WP_003436920.1.79956 WP_003436920.1.80052 WP_003436920.1.80144 WP_003436920.1.80379 WP_003436920.1.80455 WP_003436920.1.80504 WP_003436920.1.80575 WP_003436920.1.80963 WP_003436920.1.81035 WP_003436920.1.81044 WP_003436920.1.81299 WP_003436920.1.81351 WP_003436920.1.81402 WP_003436920.1.81605 WP_003436920.1.81777 WP_003436920.1.82084 WP_003436920.1.82169 WP_003436920.1.82635 WP_003436920.1.82701 WP_003436920.1.82920 WP_003436920.1.83148 WP_003436920.1.83175 WP_003436920.1.83255 WP_003436920.1.83287 WP_003436920.1.83288 WP_003436920.1.83318 WP_003436920.1.83348 WP_003436920.1.834 WP_003436920.1.83477 WP_003436920.1.83822 WP_003436920.1.83918 WP_003436920.1.84253 WP_003436920.1.84646 WP_003436920.1.84923 WP_003436920.1.85020 WP_003436920.1.85127 WP_003436920.1.85214 WP_003436920.1.85219 WP_003436920.1.85420 WP_003436920.1.85454 WP_003436920.1.85776 WP_003436920.1.8587 WP_003436920.1.85874 WP_003436920.1.85932 WP_003436920.1.86008 WP_003436920.1.86011 WP_003436920.1.86049 WP_003436920.1.86088 WP_003436920.1.86094 WP_003436920.1.86116 WP_003436920.1.86117 WP_003436920.1.86767 WP_003436920.1.86914 WP_003436920.1.87195 WP_003436920.1.87326 WP_003436920.1.87714 WP_003436920.1.87723 WP_003436920.1.87918 WP_003436920.1.88091 WP_003436920.1.882 WP_003436920.1.88268 WP_003436920.1.88332 WP_003436920.1.88364 WP_003436920.1.88608 WP_003436920.1.88640 WP_003436920.1.89052 WP_003436920.1.89065 WP_003436920.1.89196 WP_003436920.1.89457 WP_003436920.1.89629 WP_003436920.1.89697 WP_003436920.1.89994 WP_003436920.1.90101 WP_003436920.1.90164 WP_003436920.1.90329 WP_003436920.1.90491 WP_003436920.1.90555 WP_003436920.1.90643 WP_003436920.1.9083 WP_003436920.1.90921 WP_003436920.1.90938 WP_003436920.1.90981 WP_003436920.1.91254 WP_003436920.1.91314 WP_003436920.1.91570 WP_003436920.1.91648 WP_003436920.1.92075 WP_003436920.1.92371 WP_003436920.1.92576 WP_003436920.1.92697 WP_003436920.1.93044 WP_003436920.1.93171 WP_003436920.1.93313 WP_003436920.1.93615 WP_003436920.1.93687 WP_003436920.1.93717 WP_003436920.1.93766 WP_003436920.1.93782 WP_003436920.1.93798 WP_003436920.1.93802 WP_003436920.1.93830 WP_003436920.1.9393 WP_003436920.1.94067 WP_003436920.1.94073 WP_003436920.1.94166 WP_003436920.1.94427 WP_003436920.1.94768 WP_003436920.1.94968 WP_003436920.1.95095 WP_003436920.1.95173 WP_003436920.1.95350 WP_003436920.1.95517 WP_003436920.1.95847 WP_003436920.1.95893 WP_003436920.1.96113 WP_003436920.1.9635 WP_003436920.1.96503 WP_003436920.1.96505 WP_003436920.1.9666 WP_003436920.1.96690 WP_003436920.1.97219 WP_003436920.1.97458 WP_003436920.1.97672 WP_003436920.1.97682 WP_003436920.1.97806 WP_003436920.1.98037 WP_003436920.1.98514 WP_003436920.1.98698 WP_003436920.1.98715 WP_003436920.1.98856 WP_003436920.1.98997 WP_003436920.1.99134 WP_003436920.1.99333 WP_003436920.1.99542 WP_003436920.1.99545 WP_003436920.1.9986 YP_001087199.1.32744 APC36364 272563.CD0722 gi|126698302|ref|YP_001087199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]