SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126700496|ref|YP_001089393.1| from Clostridium difficile 630

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126700496|ref|YP_001089393.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.83e-36
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126700496|ref|YP_001089393.1|
Sequence length 105
Comment PTS system cellobiose-specific transporter subunit IIA [Clostridium difficile 630]
Sequence
MDEKMIEISFGIIGFAGDAKGLAFEAIKEAKSGNIDKARECIEKSKESIHKAHKFQTELI
QNEANGNKTEISVILIHAQDHLMTAMNFQQLAEEFIDVYERLESK
Download sequence
Identical sequences A0A031WJD6 A0A0H3NEW5 A0A0J0UDY7 A0A125V8M4 A0A1F2CS76 A0A2I2K051 C9YQB1 D5Q8L8 D5RV73 G6B4B9 G6BEU1 Q183W9 T4H8J2 U3UFQ9 U3V2X8 U3VCU3
gi|384362110|ref|YP_006199962.1| gi|260684462|ref|YP_003215747.1| gi|126700496|ref|YP_001089393.1| WP_003422696.1.100055 WP_003422696.1.100097 WP_003422696.1.100099 WP_003422696.1.100107 WP_003422696.1.100118 WP_003422696.1.100139 WP_003422696.1.100513 WP_003422696.1.100570 WP_003422696.1.100660 WP_003422696.1.100831 WP_003422696.1.100923 WP_003422696.1.100977 WP_003422696.1.101035 WP_003422696.1.101125 WP_003422696.1.101279 WP_003422696.1.10130 WP_003422696.1.101316 WP_003422696.1.101532 WP_003422696.1.101861 WP_003422696.1.101929 WP_003422696.1.102031 WP_003422696.1.102074 WP_003422696.1.102095 WP_003422696.1.10483 WP_003422696.1.10488 WP_003422696.1.10582 WP_003422696.1.10691 WP_003422696.1.10793 WP_003422696.1.10795 WP_003422696.1.11025 WP_003422696.1.11224 WP_003422696.1.11278 WP_003422696.1.11320 WP_003422696.1.11372 WP_003422696.1.11398 WP_003422696.1.1167 WP_003422696.1.1179 WP_003422696.1.11937 WP_003422696.1.11959 WP_003422696.1.12066 WP_003422696.1.12169 WP_003422696.1.12385 WP_003422696.1.1254 WP_003422696.1.12629 WP_003422696.1.12632 WP_003422696.1.12659 WP_003422696.1.1273 WP_003422696.1.12734 WP_003422696.1.12807 WP_003422696.1.12809 WP_003422696.1.12953 WP_003422696.1.13040 WP_003422696.1.13251 WP_003422696.1.13273 WP_003422696.1.13398 WP_003422696.1.13418 WP_003422696.1.13730 WP_003422696.1.13823 WP_003422696.1.13841 WP_003422696.1.13859 WP_003422696.1.14045 WP_003422696.1.141 WP_003422696.1.14170 WP_003422696.1.14177 WP_003422696.1.14205 WP_003422696.1.1422 WP_003422696.1.14259 WP_003422696.1.14330 WP_003422696.1.14352 WP_003422696.1.1445 WP_003422696.1.14457 WP_003422696.1.14483 WP_003422696.1.14579 WP_003422696.1.14674 WP_003422696.1.14686 WP_003422696.1.14698 WP_003422696.1.14848 WP_003422696.1.1494 WP_003422696.1.15083 WP_003422696.1.15097 WP_003422696.1.15192 WP_003422696.1.15205 WP_003422696.1.15310 WP_003422696.1.15435 WP_003422696.1.15908 WP_003422696.1.16012 WP_003422696.1.16135 WP_003422696.1.16185 WP_003422696.1.16190 WP_003422696.1.16376 WP_003422696.1.16520 WP_003422696.1.16728 WP_003422696.1.16897 WP_003422696.1.169 WP_003422696.1.16931 WP_003422696.1.16966 WP_003422696.1.1705 WP_003422696.1.17371 WP_003422696.1.17413 WP_003422696.1.17463 WP_003422696.1.17512 WP_003422696.1.17611 WP_003422696.1.17638 WP_003422696.1.17808 WP_003422696.1.17851 WP_003422696.1.17879 WP_003422696.1.17908 WP_003422696.1.17960 WP_003422696.1.17998 WP_003422696.1.18060 WP_003422696.1.18207 WP_003422696.1.18212 WP_003422696.1.18298 WP_003422696.1.1838 WP_003422696.1.18407 WP_003422696.1.18455 WP_003422696.1.18462 WP_003422696.1.18551 WP_003422696.1.18680 WP_003422696.1.18805 WP_003422696.1.18970 WP_003422696.1.19088 WP_003422696.1.19152 WP_003422696.1.1926 WP_003422696.1.19290 WP_003422696.1.1934 WP_003422696.1.19627 WP_003422696.1.19648 WP_003422696.1.19704 WP_003422696.1.19899 WP_003422696.1.19956 WP_003422696.1.1999 WP_003422696.1.2002 WP_003422696.1.20132 WP_003422696.1.20184 WP_003422696.1.20302 WP_003422696.1.20313 WP_003422696.1.20481 WP_003422696.1.20650 WP_003422696.1.20728 WP_003422696.1.20872 WP_003422696.1.20875 WP_003422696.1.20960 WP_003422696.1.21000 WP_003422696.1.21048 WP_003422696.1.21201 WP_003422696.1.21220 WP_003422696.1.21417 WP_003422696.1.21520 WP_003422696.1.21547 WP_003422696.1.21618 WP_003422696.1.21704 WP_003422696.1.21893 WP_003422696.1.21925 WP_003422696.1.21980 WP_003422696.1.22020 WP_003422696.1.22079 WP_003422696.1.22128 WP_003422696.1.22222 WP_003422696.1.22228 WP_003422696.1.22313 WP_003422696.1.22357 WP_003422696.1.22395 WP_003422696.1.22411 WP_003422696.1.22417 WP_003422696.1.22568 WP_003422696.1.22569 WP_003422696.1.22615 WP_003422696.1.22768 WP_003422696.1.22893 WP_003422696.1.22937 WP_003422696.1.23096 WP_003422696.1.23208 WP_003422696.1.23287 WP_003422696.1.23338 WP_003422696.1.2363 WP_003422696.1.24197 WP_003422696.1.24457 WP_003422696.1.24520 WP_003422696.1.24889 WP_003422696.1.24900 WP_003422696.1.24987 WP_003422696.1.25128 WP_003422696.1.25416 WP_003422696.1.25761 WP_003422696.1.26024 WP_003422696.1.26358 WP_003422696.1.26482 WP_003422696.1.26494 WP_003422696.1.26697 WP_003422696.1.26829 WP_003422696.1.26940 WP_003422696.1.27300 WP_003422696.1.27563 WP_003422696.1.27677 WP_003422696.1.27824 WP_003422696.1.27872 WP_003422696.1.27881 WP_003422696.1.27890 WP_003422696.1.27967 WP_003422696.1.27989 WP_003422696.1.27996 WP_003422696.1.28055 WP_003422696.1.28410 WP_003422696.1.28638 WP_003422696.1.28715 WP_003422696.1.28856 WP_003422696.1.28882 WP_003422696.1.28890 WP_003422696.1.28930 WP_003422696.1.2923 WP_003422696.1.293 WP_003422696.1.29600 WP_003422696.1.29757 WP_003422696.1.2982 WP_003422696.1.29891 WP_003422696.1.29939 WP_003422696.1.3024 WP_003422696.1.303 WP_003422696.1.3031 WP_003422696.1.30420 WP_003422696.1.30431 WP_003422696.1.30463 WP_003422696.1.30519 WP_003422696.1.30521 WP_003422696.1.30743 WP_003422696.1.30841 WP_003422696.1.30953 WP_003422696.1.31160 WP_003422696.1.31183 WP_003422696.1.31203 WP_003422696.1.31292 WP_003422696.1.31309 WP_003422696.1.31351 WP_003422696.1.31385 WP_003422696.1.31453 WP_003422696.1.31475 WP_003422696.1.31477 WP_003422696.1.31519 WP_003422696.1.31637 WP_003422696.1.31719 WP_003422696.1.31742 WP_003422696.1.31960 WP_003422696.1.31969 WP_003422696.1.32008 WP_003422696.1.32066 WP_003422696.1.32119 WP_003422696.1.32166 WP_003422696.1.32197 WP_003422696.1.32218 WP_003422696.1.32230 WP_003422696.1.32294 WP_003422696.1.32699 WP_003422696.1.32769 WP_003422696.1.32776 WP_003422696.1.32842 WP_003422696.1.32953 WP_003422696.1.33056 WP_003422696.1.33098 WP_003422696.1.33164 WP_003422696.1.33275 WP_003422696.1.33298 WP_003422696.1.33332 WP_003422696.1.33349 WP_003422696.1.3340 WP_003422696.1.33514 WP_003422696.1.33810 WP_003422696.1.34388 WP_003422696.1.34489 WP_003422696.1.34545 WP_003422696.1.34641 WP_003422696.1.34800 WP_003422696.1.34985 WP_003422696.1.34989 WP_003422696.1.35 WP_003422696.1.35002 WP_003422696.1.35137 WP_003422696.1.35181 WP_003422696.1.35187 WP_003422696.1.35234 WP_003422696.1.3559 WP_003422696.1.35709 WP_003422696.1.35832 WP_003422696.1.35884 WP_003422696.1.36078 WP_003422696.1.36257 WP_003422696.1.36338 WP_003422696.1.36738 WP_003422696.1.36835 WP_003422696.1.37255 WP_003422696.1.374 WP_003422696.1.37493 WP_003422696.1.37532 WP_003422696.1.37597 WP_003422696.1.37861 WP_003422696.1.3789 WP_003422696.1.37957 WP_003422696.1.37981 WP_003422696.1.38305 WP_003422696.1.38338 WP_003422696.1.38692 WP_003422696.1.38775 WP_003422696.1.38814 WP_003422696.1.38874 WP_003422696.1.38924 WP_003422696.1.38986 WP_003422696.1.39008 WP_003422696.1.3913 WP_003422696.1.39213 WP_003422696.1.39350 WP_003422696.1.39382 WP_003422696.1.39442 WP_003422696.1.39525 WP_003422696.1.39621 WP_003422696.1.39783 WP_003422696.1.39874 WP_003422696.1.39876 WP_003422696.1.39975 WP_003422696.1.39981 WP_003422696.1.40030 WP_003422696.1.40294 WP_003422696.1.40313 WP_003422696.1.40447 WP_003422696.1.40516 WP_003422696.1.40522 WP_003422696.1.40557 WP_003422696.1.407 WP_003422696.1.40775 WP_003422696.1.40891 WP_003422696.1.40959 WP_003422696.1.40966 WP_003422696.1.41131 WP_003422696.1.4121 WP_003422696.1.41334 WP_003422696.1.41342 WP_003422696.1.4137 WP_003422696.1.41506 WP_003422696.1.41534 WP_003422696.1.41641 WP_003422696.1.41687 WP_003422696.1.41818 WP_003422696.1.41995 WP_003422696.1.42035 WP_003422696.1.4204 WP_003422696.1.42066 WP_003422696.1.42532 WP_003422696.1.42533 WP_003422696.1.42610 WP_003422696.1.42664 WP_003422696.1.43112 WP_003422696.1.4315 WP_003422696.1.4321 WP_003422696.1.43388 WP_003422696.1.43490 WP_003422696.1.43519 WP_003422696.1.43579 WP_003422696.1.43663 WP_003422696.1.43824 WP_003422696.1.4383 WP_003422696.1.44030 WP_003422696.1.44105 WP_003422696.1.44149 WP_003422696.1.44198 WP_003422696.1.44241 WP_003422696.1.44470 WP_003422696.1.44471 WP_003422696.1.44729 WP_003422696.1.45017 WP_003422696.1.45059 WP_003422696.1.45142 WP_003422696.1.45165 WP_003422696.1.45209 WP_003422696.1.45257 WP_003422696.1.45352 WP_003422696.1.45554 WP_003422696.1.4573 WP_003422696.1.45938 WP_003422696.1.45986 WP_003422696.1.46066 WP_003422696.1.46117 WP_003422696.1.46274 WP_003422696.1.46280 WP_003422696.1.46305 WP_003422696.1.46522 WP_003422696.1.4698 WP_003422696.1.47016 WP_003422696.1.47121 WP_003422696.1.47173 WP_003422696.1.47227 WP_003422696.1.47228 WP_003422696.1.47479 WP_003422696.1.47615 WP_003422696.1.47708 WP_003422696.1.47729 WP_003422696.1.47940 WP_003422696.1.48220 WP_003422696.1.48246 WP_003422696.1.48279 WP_003422696.1.4835 WP_003422696.1.48491 WP_003422696.1.48733 WP_003422696.1.48746 WP_003422696.1.48772 WP_003422696.1.48935 WP_003422696.1.48980 WP_003422696.1.48983 WP_003422696.1.48991 WP_003422696.1.49020 WP_003422696.1.49054 WP_003422696.1.49065 WP_003422696.1.4908 WP_003422696.1.49092 WP_003422696.1.49230 WP_003422696.1.49310 WP_003422696.1.49339 WP_003422696.1.49451 WP_003422696.1.4948 WP_003422696.1.49633 WP_003422696.1.50159 WP_003422696.1.50341 WP_003422696.1.50460 WP_003422696.1.50495 WP_003422696.1.5073 WP_003422696.1.50865 WP_003422696.1.51007 WP_003422696.1.51166 WP_003422696.1.51235 WP_003422696.1.51675 WP_003422696.1.5187 WP_003422696.1.51996 WP_003422696.1.52073 WP_003422696.1.52164 WP_003422696.1.52266 WP_003422696.1.52278 WP_003422696.1.52311 WP_003422696.1.52330 WP_003422696.1.52383 WP_003422696.1.52402 WP_003422696.1.52466 WP_003422696.1.52525 WP_003422696.1.52789 WP_003422696.1.52958 WP_003422696.1.52997 WP_003422696.1.53008 WP_003422696.1.53044 WP_003422696.1.53055 WP_003422696.1.53288 WP_003422696.1.5337 WP_003422696.1.53504 WP_003422696.1.53704 WP_003422696.1.53710 WP_003422696.1.53729 WP_003422696.1.53987 WP_003422696.1.54058 WP_003422696.1.54153 WP_003422696.1.5423 WP_003422696.1.54262 WP_003422696.1.54586 WP_003422696.1.54692 WP_003422696.1.55055 WP_003422696.1.55101 WP_003422696.1.5521 WP_003422696.1.55302 WP_003422696.1.55371 WP_003422696.1.5558 WP_003422696.1.559 WP_003422696.1.56006 WP_003422696.1.56217 WP_003422696.1.56252 WP_003422696.1.56323 WP_003422696.1.56337 WP_003422696.1.5657 WP_003422696.1.5661 WP_003422696.1.5664 WP_003422696.1.56664 WP_003422696.1.56711 WP_003422696.1.56754 WP_003422696.1.56927 WP_003422696.1.56998 WP_003422696.1.57099 WP_003422696.1.57337 WP_003422696.1.5750 WP_003422696.1.57711 WP_003422696.1.57827 WP_003422696.1.58015 WP_003422696.1.58216 WP_003422696.1.58304 WP_003422696.1.58315 WP_003422696.1.58323 WP_003422696.1.58463 WP_003422696.1.58531 WP_003422696.1.58665 WP_003422696.1.58677 WP_003422696.1.58711 WP_003422696.1.58818 WP_003422696.1.58956 WP_003422696.1.59032 WP_003422696.1.5905 WP_003422696.1.59588 WP_003422696.1.59618 WP_003422696.1.59628 WP_003422696.1.59707 WP_003422696.1.59752 WP_003422696.1.59990 WP_003422696.1.60040 WP_003422696.1.6031 WP_003422696.1.60482 WP_003422696.1.60563 WP_003422696.1.6070 WP_003422696.1.60957 WP_003422696.1.60998 WP_003422696.1.61042 WP_003422696.1.61140 WP_003422696.1.61293 WP_003422696.1.61492 WP_003422696.1.61679 WP_003422696.1.61716 WP_003422696.1.61866 WP_003422696.1.61972 WP_003422696.1.62049 WP_003422696.1.62095 WP_003422696.1.62128 WP_003422696.1.62340 WP_003422696.1.62577 WP_003422696.1.62624 WP_003422696.1.62637 WP_003422696.1.62797 WP_003422696.1.62941 WP_003422696.1.63020 WP_003422696.1.63059 WP_003422696.1.63237 WP_003422696.1.63239 WP_003422696.1.63248 WP_003422696.1.63343 WP_003422696.1.63378 WP_003422696.1.63516 WP_003422696.1.63570 WP_003422696.1.63581 WP_003422696.1.63598 WP_003422696.1.63599 WP_003422696.1.63696 WP_003422696.1.63804 WP_003422696.1.63852 WP_003422696.1.63853 WP_003422696.1.63950 WP_003422696.1.64020 WP_003422696.1.64092 WP_003422696.1.64197 WP_003422696.1.64369 WP_003422696.1.64447 WP_003422696.1.64546 WP_003422696.1.64573 WP_003422696.1.64859 WP_003422696.1.65064 WP_003422696.1.65067 WP_003422696.1.65313 WP_003422696.1.65369 WP_003422696.1.65889 WP_003422696.1.66084 WP_003422696.1.66119 WP_003422696.1.66237 WP_003422696.1.66439 WP_003422696.1.66474 WP_003422696.1.66565 WP_003422696.1.66608 WP_003422696.1.66643 WP_003422696.1.66701 WP_003422696.1.6671 WP_003422696.1.6675 WP_003422696.1.66805 WP_003422696.1.66847 WP_003422696.1.6685 WP_003422696.1.66887 WP_003422696.1.66888 WP_003422696.1.66900 WP_003422696.1.670 WP_003422696.1.67303 WP_003422696.1.67308 WP_003422696.1.6736 WP_003422696.1.67368 WP_003422696.1.67528 WP_003422696.1.67689 WP_003422696.1.67695 WP_003422696.1.67711 WP_003422696.1.6792 WP_003422696.1.67951 WP_003422696.1.68150 WP_003422696.1.68276 WP_003422696.1.68322 WP_003422696.1.68955 WP_003422696.1.6898 WP_003422696.1.68980 WP_003422696.1.69114 WP_003422696.1.692 WP_003422696.1.69220 WP_003422696.1.69333 WP_003422696.1.69495 WP_003422696.1.69708 WP_003422696.1.6994 WP_003422696.1.700 WP_003422696.1.70152 WP_003422696.1.70179 WP_003422696.1.70231 WP_003422696.1.70320 WP_003422696.1.70464 WP_003422696.1.70695 WP_003422696.1.70710 WP_003422696.1.70820 WP_003422696.1.70886 WP_003422696.1.71079 WP_003422696.1.71119 WP_003422696.1.713 WP_003422696.1.71384 WP_003422696.1.71477 WP_003422696.1.7156 WP_003422696.1.71745 WP_003422696.1.7199 WP_003422696.1.72113 WP_003422696.1.72245 WP_003422696.1.72468 WP_003422696.1.72483 WP_003422696.1.72560 WP_003422696.1.72681 WP_003422696.1.72682 WP_003422696.1.72891 WP_003422696.1.72909 WP_003422696.1.72914 WP_003422696.1.72994 WP_003422696.1.73026 WP_003422696.1.73116 WP_003422696.1.7322 WP_003422696.1.73605 WP_003422696.1.73836 WP_003422696.1.73852 WP_003422696.1.73931 WP_003422696.1.74050 WP_003422696.1.74116 WP_003422696.1.74126 WP_003422696.1.74672 WP_003422696.1.74678 WP_003422696.1.74680 WP_003422696.1.74779 WP_003422696.1.74835 WP_003422696.1.74897 WP_003422696.1.75026 WP_003422696.1.751 WP_003422696.1.75210 WP_003422696.1.75226 WP_003422696.1.75287 WP_003422696.1.75454 WP_003422696.1.75638 WP_003422696.1.75659 WP_003422696.1.76207 WP_003422696.1.7650 WP_003422696.1.76550 WP_003422696.1.76552 WP_003422696.1.76603 WP_003422696.1.76621 WP_003422696.1.76664 WP_003422696.1.76687 WP_003422696.1.76793 WP_003422696.1.76813 WP_003422696.1.76882 WP_003422696.1.76924 WP_003422696.1.7696 WP_003422696.1.77092 WP_003422696.1.77102 WP_003422696.1.77473 WP_003422696.1.77509 WP_003422696.1.77544 WP_003422696.1.7755 WP_003422696.1.77639 WP_003422696.1.77782 WP_003422696.1.77842 WP_003422696.1.77942 WP_003422696.1.78123 WP_003422696.1.78579 WP_003422696.1.78949 WP_003422696.1.79125 WP_003422696.1.7916 WP_003422696.1.79199 WP_003422696.1.79221 WP_003422696.1.79309 WP_003422696.1.79344 WP_003422696.1.79437 WP_003422696.1.79611 WP_003422696.1.79673 WP_003422696.1.79680 WP_003422696.1.79703 WP_003422696.1.79836 WP_003422696.1.79956 WP_003422696.1.80052 WP_003422696.1.80144 WP_003422696.1.80342 WP_003422696.1.80379 WP_003422696.1.80455 WP_003422696.1.80504 WP_003422696.1.80575 WP_003422696.1.80610 WP_003422696.1.80963 WP_003422696.1.81035 WP_003422696.1.81044 WP_003422696.1.81208 WP_003422696.1.81299 WP_003422696.1.81351 WP_003422696.1.81402 WP_003422696.1.81605 WP_003422696.1.82084 WP_003422696.1.82150 WP_003422696.1.82169 WP_003422696.1.82335 WP_003422696.1.82635 WP_003422696.1.82701 WP_003422696.1.82920 WP_003422696.1.8314 WP_003422696.1.83148 WP_003422696.1.83175 WP_003422696.1.83255 WP_003422696.1.83287 WP_003422696.1.83288 WP_003422696.1.83318 WP_003422696.1.83348 WP_003422696.1.8336 WP_003422696.1.834 WP_003422696.1.83477 WP_003422696.1.83515 WP_003422696.1.83641 WP_003422696.1.83822 WP_003422696.1.83918 WP_003422696.1.84195 WP_003422696.1.84253 WP_003422696.1.84528 WP_003422696.1.84606 WP_003422696.1.84646 WP_003422696.1.84843 WP_003422696.1.84880 WP_003422696.1.84923 WP_003422696.1.85020 WP_003422696.1.85127 WP_003422696.1.85214 WP_003422696.1.85219 WP_003422696.1.8527 WP_003422696.1.85420 WP_003422696.1.85442 WP_003422696.1.85454 WP_003422696.1.85776 WP_003422696.1.85863 WP_003422696.1.8587 WP_003422696.1.85874 WP_003422696.1.85932 WP_003422696.1.86008 WP_003422696.1.86011 WP_003422696.1.86049 WP_003422696.1.86088 WP_003422696.1.86094 WP_003422696.1.86116 WP_003422696.1.86117 WP_003422696.1.86328 WP_003422696.1.86395 WP_003422696.1.86534 WP_003422696.1.86618 WP_003422696.1.86743 WP_003422696.1.86767 WP_003422696.1.86914 WP_003422696.1.87058 WP_003422696.1.87195 WP_003422696.1.87326 WP_003422696.1.87454 WP_003422696.1.87714 WP_003422696.1.87723 WP_003422696.1.87730 WP_003422696.1.87918 WP_003422696.1.87932 WP_003422696.1.882 WP_003422696.1.88268 WP_003422696.1.88332 WP_003422696.1.88364 WP_003422696.1.88372 WP_003422696.1.88377 WP_003422696.1.88608 WP_003422696.1.88640 WP_003422696.1.88996 WP_003422696.1.89052 WP_003422696.1.89065 WP_003422696.1.89196 WP_003422696.1.89337 WP_003422696.1.89364 WP_003422696.1.89457 WP_003422696.1.89629 WP_003422696.1.89697 WP_003422696.1.8984 WP_003422696.1.89994 WP_003422696.1.90076 WP_003422696.1.90101 WP_003422696.1.90164 WP_003422696.1.90329 WP_003422696.1.9041 WP_003422696.1.90491 WP_003422696.1.90555 WP_003422696.1.90643 WP_003422696.1.9083 WP_003422696.1.90921 WP_003422696.1.90938 WP_003422696.1.90981 WP_003422696.1.90985 WP_003422696.1.91065 WP_003422696.1.91254 WP_003422696.1.91314 WP_003422696.1.91406 WP_003422696.1.91570 WP_003422696.1.91648 WP_003422696.1.92075 WP_003422696.1.92284 WP_003422696.1.92371 WP_003422696.1.92576 WP_003422696.1.92658 WP_003422696.1.92697 WP_003422696.1.92941 WP_003422696.1.93044 WP_003422696.1.93171 WP_003422696.1.93313 WP_003422696.1.93360 WP_003422696.1.93480 WP_003422696.1.93615 WP_003422696.1.93687 WP_003422696.1.93717 WP_003422696.1.93782 WP_003422696.1.93798 WP_003422696.1.93802 WP_003422696.1.93830 WP_003422696.1.9393 WP_003422696.1.93968 WP_003422696.1.94067 WP_003422696.1.94073 WP_003422696.1.94166 WP_003422696.1.94427 WP_003422696.1.94768 WP_003422696.1.94831 WP_003422696.1.94968 WP_003422696.1.95095 WP_003422696.1.95173 WP_003422696.1.9522 WP_003422696.1.95350 WP_003422696.1.95517 WP_003422696.1.9580 WP_003422696.1.95847 WP_003422696.1.95893 WP_003422696.1.96113 WP_003422696.1.9635 WP_003422696.1.96503 WP_003422696.1.96505 WP_003422696.1.9666 WP_003422696.1.96690 WP_003422696.1.96765 WP_003422696.1.97219 WP_003422696.1.97432 WP_003422696.1.97458 WP_003422696.1.97672 WP_003422696.1.97682 WP_003422696.1.97806 WP_003422696.1.98037 WP_003422696.1.98514 WP_003422696.1.98622 WP_003422696.1.98698 WP_003422696.1.98715 WP_003422696.1.98748 WP_003422696.1.98856 WP_003422696.1.98913 WP_003422696.1.98997 WP_003422696.1.99064 WP_003422696.1.99134 WP_003422696.1.99333 WP_003422696.1.99542 WP_003422696.1.99545 WP_003422696.1.99731 WP_003422696.1.9986 YP_001089393.1.32744 272563.CD2880 645462.CD196_2729 645463.CDR20291_2776 gi|260688121|ref|YP_003219255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]