SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126700697|ref|YP_001089594.1| from Clostridium difficile 630

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126700697|ref|YP_001089594.1|
Domain Number 1 Region: 9-107
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.19e-27
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126700697|ref|YP_001089594.1|
Sequence length 117
Comment PTS system lactose/cellobiose-family transporter subunit IIA [Clostridium difficile 630]
Sequence
MTIEEHIIDEELVEVAMQIILRAGEARTEIKHALNDLEKFDYRNADLKLAKAKGFMTEAH
RAQTKIIQGEAGGEKRAHSLLFAHAQDTLMTIFSELNITMSLVGIVKSIEYKVNNSK
Download sequence
Identical sequences A0A069AJY7 A0A0J0UED5 Q184R7
WP_003439961.1.100055 WP_003439961.1.100107 WP_003439961.1.100118 WP_003439961.1.100570 WP_003439961.1.101125 WP_003439961.1.101279 WP_003439961.1.101316 WP_003439961.1.102074 WP_003439961.1.102095 WP_003439961.1.10483 WP_003439961.1.10691 WP_003439961.1.10793 WP_003439961.1.10795 WP_003439961.1.11278 WP_003439961.1.11320 WP_003439961.1.11398 WP_003439961.1.1167 WP_003439961.1.11937 WP_003439961.1.12066 WP_003439961.1.1254 WP_003439961.1.12632 WP_003439961.1.12659 WP_003439961.1.13273 WP_003439961.1.13730 WP_003439961.1.13841 WP_003439961.1.13859 WP_003439961.1.14177 WP_003439961.1.14259 WP_003439961.1.14352 WP_003439961.1.14457 WP_003439961.1.14579 WP_003439961.1.14686 WP_003439961.1.14698 WP_003439961.1.1494 WP_003439961.1.15083 WP_003439961.1.15097 WP_003439961.1.15435 WP_003439961.1.15908 WP_003439961.1.16190 WP_003439961.1.16376 WP_003439961.1.169 WP_003439961.1.17371 WP_003439961.1.17611 WP_003439961.1.17808 WP_003439961.1.17960 WP_003439961.1.18060 WP_003439961.1.18207 WP_003439961.1.1838 WP_003439961.1.18551 WP_003439961.1.18805 WP_003439961.1.18970 WP_003439961.1.19088 WP_003439961.1.1926 WP_003439961.1.19290 WP_003439961.1.1934 WP_003439961.1.19627 WP_003439961.1.19648 WP_003439961.1.19956 WP_003439961.1.2002 WP_003439961.1.20184 WP_003439961.1.20302 WP_003439961.1.20313 WP_003439961.1.20872 WP_003439961.1.20960 WP_003439961.1.21000 WP_003439961.1.21048 WP_003439961.1.21201 WP_003439961.1.21417 WP_003439961.1.21520 WP_003439961.1.22079 WP_003439961.1.22228 WP_003439961.1.22313 WP_003439961.1.22411 WP_003439961.1.22417 WP_003439961.1.22569 WP_003439961.1.22615 WP_003439961.1.22768 WP_003439961.1.22893 WP_003439961.1.23208 WP_003439961.1.23287 WP_003439961.1.23338 WP_003439961.1.24197 WP_003439961.1.24889 WP_003439961.1.25128 WP_003439961.1.26024 WP_003439961.1.26482 WP_003439961.1.26940 WP_003439961.1.27563 WP_003439961.1.27708 WP_003439961.1.27872 WP_003439961.1.27890 WP_003439961.1.27996 WP_003439961.1.28410 WP_003439961.1.28638 WP_003439961.1.28715 WP_003439961.1.28856 WP_003439961.1.28890 WP_003439961.1.293 WP_003439961.1.29600 WP_003439961.1.29757 WP_003439961.1.29891 WP_003439961.1.30420 WP_003439961.1.30431 WP_003439961.1.30463 WP_003439961.1.30521 WP_003439961.1.30743 WP_003439961.1.30841 WP_003439961.1.30953 WP_003439961.1.31203 WP_003439961.1.31292 WP_003439961.1.31309 WP_003439961.1.31477 WP_003439961.1.31637 WP_003439961.1.31969 WP_003439961.1.32008 WP_003439961.1.32066 WP_003439961.1.32166 WP_003439961.1.32294 WP_003439961.1.32776 WP_003439961.1.32842 WP_003439961.1.33056 WP_003439961.1.33098 WP_003439961.1.33298 WP_003439961.1.33349 WP_003439961.1.3340 WP_003439961.1.34545 WP_003439961.1.34641 WP_003439961.1.34800 WP_003439961.1.34985 WP_003439961.1.35 WP_003439961.1.35002 WP_003439961.1.35137 WP_003439961.1.35187 WP_003439961.1.35234 WP_003439961.1.3559 WP_003439961.1.35709 WP_003439961.1.35884 WP_003439961.1.36257 WP_003439961.1.36738 WP_003439961.1.37255 WP_003439961.1.374 WP_003439961.1.37493 WP_003439961.1.37597 WP_003439961.1.37861 WP_003439961.1.37957 WP_003439961.1.38305 WP_003439961.1.38338 WP_003439961.1.38692 WP_003439961.1.38775 WP_003439961.1.38814 WP_003439961.1.38874 WP_003439961.1.3913 WP_003439961.1.39382 WP_003439961.1.39442 WP_003439961.1.39621 WP_003439961.1.39874 WP_003439961.1.40030 WP_003439961.1.40294 WP_003439961.1.40313 WP_003439961.1.40447 WP_003439961.1.40557 WP_003439961.1.407 WP_003439961.1.40959 WP_003439961.1.40966 WP_003439961.1.4121 WP_003439961.1.4137 WP_003439961.1.41641 WP_003439961.1.41818 WP_003439961.1.41995 WP_003439961.1.4204 WP_003439961.1.42066 WP_003439961.1.42533 WP_003439961.1.42610 WP_003439961.1.43112 WP_003439961.1.43490 WP_003439961.1.43519 WP_003439961.1.43824 WP_003439961.1.4383 WP_003439961.1.44030 WP_003439961.1.44149 WP_003439961.1.44198 WP_003439961.1.44241 WP_003439961.1.44729 WP_003439961.1.45017 WP_003439961.1.45142 WP_003439961.1.45209 WP_003439961.1.45352 WP_003439961.1.45554 WP_003439961.1.4573 WP_003439961.1.46280 WP_003439961.1.4698 WP_003439961.1.47228 WP_003439961.1.47479 WP_003439961.1.47615 WP_003439961.1.47708 WP_003439961.1.47729 WP_003439961.1.48246 WP_003439961.1.48733 WP_003439961.1.48746 WP_003439961.1.48983 WP_003439961.1.49054 WP_003439961.1.49065 WP_003439961.1.4908 WP_003439961.1.49092 WP_003439961.1.4948 WP_003439961.1.49633 WP_003439961.1.50159 WP_003439961.1.50341 WP_003439961.1.5073 WP_003439961.1.50865 WP_003439961.1.51007 WP_003439961.1.51235 WP_003439961.1.51675 WP_003439961.1.51996 WP_003439961.1.52311 WP_003439961.1.52330 WP_003439961.1.52958 WP_003439961.1.53008 WP_003439961.1.53055 WP_003439961.1.5337 WP_003439961.1.53504 WP_003439961.1.53987 WP_003439961.1.54058 WP_003439961.1.54153 WP_003439961.1.54350 WP_003439961.1.54586 WP_003439961.1.55055 WP_003439961.1.55101 WP_003439961.1.5521 WP_003439961.1.55302 WP_003439961.1.55371 WP_003439961.1.55391 WP_003439961.1.559 WP_003439961.1.56006 WP_003439961.1.56323 WP_003439961.1.56556 WP_003439961.1.5657 WP_003439961.1.5664 WP_003439961.1.56664 WP_003439961.1.56711 WP_003439961.1.56754 WP_003439961.1.56927 WP_003439961.1.56998 WP_003439961.1.58216 WP_003439961.1.58304 WP_003439961.1.58463 WP_003439961.1.58677 WP_003439961.1.5905 WP_003439961.1.59628 WP_003439961.1.59752 WP_003439961.1.59990 WP_003439961.1.6031 WP_003439961.1.60482 WP_003439961.1.60563 WP_003439961.1.60998 WP_003439961.1.61042 WP_003439961.1.61140 WP_003439961.1.61293 WP_003439961.1.61716 WP_003439961.1.62128 WP_003439961.1.62577 WP_003439961.1.62986 WP_003439961.1.63020 WP_003439961.1.63059 WP_003439961.1.63343 WP_003439961.1.63516 WP_003439961.1.63570 WP_003439961.1.63598 WP_003439961.1.63696 WP_003439961.1.64020 WP_003439961.1.64092 WP_003439961.1.64546 WP_003439961.1.64859 WP_003439961.1.65067 WP_003439961.1.65369 WP_003439961.1.65889 WP_003439961.1.66084 WP_003439961.1.66237 WP_003439961.1.66439 WP_003439961.1.66474 WP_003439961.1.66587 WP_003439961.1.66643 WP_003439961.1.66701 WP_003439961.1.66847 WP_003439961.1.67308 WP_003439961.1.67368 WP_003439961.1.67689 WP_003439961.1.6792 WP_003439961.1.67951 WP_003439961.1.68980 WP_003439961.1.692 WP_003439961.1.69333 WP_003439961.1.69708 WP_003439961.1.6994 WP_003439961.1.70231 WP_003439961.1.70320 WP_003439961.1.71079 WP_003439961.1.71119 WP_003439961.1.71384 WP_003439961.1.7199 WP_003439961.1.72113 WP_003439961.1.72245 WP_003439961.1.72468 WP_003439961.1.72483 WP_003439961.1.72560 WP_003439961.1.72891 WP_003439961.1.72914 WP_003439961.1.72994 WP_003439961.1.73026 WP_003439961.1.73116 WP_003439961.1.73836 WP_003439961.1.73852 WP_003439961.1.74126 WP_003439961.1.74678 WP_003439961.1.74779 WP_003439961.1.74835 WP_003439961.1.74897 WP_003439961.1.75026 WP_003439961.1.75454 WP_003439961.1.75638 WP_003439961.1.76207 WP_003439961.1.76550 WP_003439961.1.76552 WP_003439961.1.76603 WP_003439961.1.76621 WP_003439961.1.76664 WP_003439961.1.7696 WP_003439961.1.77102 WP_003439961.1.77473 WP_003439961.1.77639 WP_003439961.1.77942 WP_003439961.1.78123 WP_003439961.1.78579 WP_003439961.1.78949 WP_003439961.1.7916 WP_003439961.1.79221 WP_003439961.1.79309 WP_003439961.1.79344 WP_003439961.1.79703 WP_003439961.1.79836 WP_003439961.1.80052 WP_003439961.1.80342 WP_003439961.1.80379 WP_003439961.1.80504 WP_003439961.1.80575 WP_003439961.1.80963 WP_003439961.1.81035 WP_003439961.1.81044 WP_003439961.1.81351 WP_003439961.1.81605 WP_003439961.1.81777 WP_003439961.1.82084 WP_003439961.1.82635 WP_003439961.1.82701 WP_003439961.1.83148 WP_003439961.1.83175 WP_003439961.1.83255 WP_003439961.1.83287 WP_003439961.1.83288 WP_003439961.1.83318 WP_003439961.1.83348 WP_003439961.1.8336 WP_003439961.1.834 WP_003439961.1.83477 WP_003439961.1.83822 WP_003439961.1.84528 WP_003439961.1.84646 WP_003439961.1.84923 WP_003439961.1.85020 WP_003439961.1.85127 WP_003439961.1.85214 WP_003439961.1.85219 WP_003439961.1.85454 WP_003439961.1.85776 WP_003439961.1.85863 WP_003439961.1.85874 WP_003439961.1.85932 WP_003439961.1.86008 WP_003439961.1.86011 WP_003439961.1.86049 WP_003439961.1.86088 WP_003439961.1.86094 WP_003439961.1.86117 WP_003439961.1.86743 WP_003439961.1.86837 WP_003439961.1.86914 WP_003439961.1.87195 WP_003439961.1.87326 WP_003439961.1.87714 WP_003439961.1.87918 WP_003439961.1.88091 WP_003439961.1.882 WP_003439961.1.88268 WP_003439961.1.88332 WP_003439961.1.88608 WP_003439961.1.88996 WP_003439961.1.89196 WP_003439961.1.89697 WP_003439961.1.8984 WP_003439961.1.89994 WP_003439961.1.90101 WP_003439961.1.90164 WP_003439961.1.90491 WP_003439961.1.90555 WP_003439961.1.90643 WP_003439961.1.9083 WP_003439961.1.90921 WP_003439961.1.90938 WP_003439961.1.91254 WP_003439961.1.91648 WP_003439961.1.92075 WP_003439961.1.92284 WP_003439961.1.92576 WP_003439961.1.93044 WP_003439961.1.93171 WP_003439961.1.93480 WP_003439961.1.93615 WP_003439961.1.93687 WP_003439961.1.93717 WP_003439961.1.93766 WP_003439961.1.93798 WP_003439961.1.93830 WP_003439961.1.93968 WP_003439961.1.94073 WP_003439961.1.94166 WP_003439961.1.94427 WP_003439961.1.94768 WP_003439961.1.94968 WP_003439961.1.95173 WP_003439961.1.95350 WP_003439961.1.95847 WP_003439961.1.95893 WP_003439961.1.96113 WP_003439961.1.9635 WP_003439961.1.96503 WP_003439961.1.9666 WP_003439961.1.96690 WP_003439961.1.97219 WP_003439961.1.97458 WP_003439961.1.97672 WP_003439961.1.98037 WP_003439961.1.98715 WP_003439961.1.98997 WP_003439961.1.99064 WP_003439961.1.99134 WP_003439961.1.99333 WP_003439961.1.99542 WP_003439961.1.9986 YP_001089594.1.32744 272563.CD3080 gi|126700697|ref|YP_001089594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]