SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126701068|ref|YP_001089965.1| from Clostridium difficile 630

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126701068|ref|YP_001089965.1|
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.53e-28
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126701068|ref|YP_001089965.1|
Sequence length 101
Comment PTS system lactose/cellobiose-family transporter subunit IIA [Clostridium difficile 630]
Sequence
MSTEVQIMELISTAGESKSKAFEALKKVKSKDFKGAKLLIEEARKIDIEAHRIQTELITQ
DLNEDVESPAMSLLMVHAQDHYMTSQLAKDLIEALIYCLDK
Download sequence
Identical sequences A0A031WHQ5 A0A125YDV8 A0A2I2K2K2 D5PZE9 D5S184 Q180U4 U3UEW0 U3V4G0 U3VFW2
WP_003421329.1.100055 WP_003421329.1.100107 WP_003421329.1.100118 WP_003421329.1.100513 WP_003421329.1.100570 WP_003421329.1.100660 WP_003421329.1.100831 WP_003421329.1.101035 WP_003421329.1.101125 WP_003421329.1.101279 WP_003421329.1.101316 WP_003421329.1.101532 WP_003421329.1.101861 WP_003421329.1.102031 WP_003421329.1.102074 WP_003421329.1.102095 WP_003421329.1.10483 WP_003421329.1.10582 WP_003421329.1.10691 WP_003421329.1.10793 WP_003421329.1.10795 WP_003421329.1.11224 WP_003421329.1.11278 WP_003421329.1.11320 WP_003421329.1.11372 WP_003421329.1.11398 WP_003421329.1.1167 WP_003421329.1.1179 WP_003421329.1.11937 WP_003421329.1.12066 WP_003421329.1.12385 WP_003421329.1.1254 WP_003421329.1.12629 WP_003421329.1.12632 WP_003421329.1.12659 WP_003421329.1.12734 WP_003421329.1.12807 WP_003421329.1.13273 WP_003421329.1.13418 WP_003421329.1.13730 WP_003421329.1.13823 WP_003421329.1.13841 WP_003421329.1.13859 WP_003421329.1.14045 WP_003421329.1.141 WP_003421329.1.14177 WP_003421329.1.1422 WP_003421329.1.14259 WP_003421329.1.14330 WP_003421329.1.14352 WP_003421329.1.14457 WP_003421329.1.14579 WP_003421329.1.14686 WP_003421329.1.14698 WP_003421329.1.14848 WP_003421329.1.1494 WP_003421329.1.15083 WP_003421329.1.15097 WP_003421329.1.15192 WP_003421329.1.15205 WP_003421329.1.15310 WP_003421329.1.15435 WP_003421329.1.15908 WP_003421329.1.16012 WP_003421329.1.16135 WP_003421329.1.16185 WP_003421329.1.16190 WP_003421329.1.16376 WP_003421329.1.169 WP_003421329.1.16966 WP_003421329.1.1705 WP_003421329.1.17371 WP_003421329.1.17413 WP_003421329.1.17463 WP_003421329.1.17512 WP_003421329.1.17611 WP_003421329.1.17808 WP_003421329.1.17960 WP_003421329.1.17998 WP_003421329.1.18060 WP_003421329.1.18207 WP_003421329.1.1838 WP_003421329.1.18407 WP_003421329.1.18462 WP_003421329.1.18551 WP_003421329.1.18805 WP_003421329.1.18970 WP_003421329.1.19088 WP_003421329.1.1926 WP_003421329.1.19290 WP_003421329.1.1934 WP_003421329.1.19627 WP_003421329.1.19648 WP_003421329.1.19704 WP_003421329.1.19956 WP_003421329.1.1999 WP_003421329.1.2002 WP_003421329.1.20184 WP_003421329.1.20302 WP_003421329.1.20313 WP_003421329.1.20481 WP_003421329.1.20728 WP_003421329.1.20872 WP_003421329.1.20960 WP_003421329.1.21000 WP_003421329.1.21048 WP_003421329.1.21201 WP_003421329.1.21417 WP_003421329.1.21520 WP_003421329.1.21547 WP_003421329.1.21704 WP_003421329.1.21893 WP_003421329.1.21925 WP_003421329.1.21980 WP_003421329.1.22079 WP_003421329.1.22228 WP_003421329.1.22313 WP_003421329.1.22395 WP_003421329.1.22411 WP_003421329.1.22417 WP_003421329.1.22568 WP_003421329.1.22569 WP_003421329.1.22615 WP_003421329.1.22768 WP_003421329.1.22893 WP_003421329.1.23096 WP_003421329.1.23208 WP_003421329.1.23287 WP_003421329.1.23338 WP_003421329.1.24197 WP_003421329.1.24457 WP_003421329.1.24520 WP_003421329.1.24889 WP_003421329.1.24900 WP_003421329.1.24987 WP_003421329.1.25128 WP_003421329.1.25416 WP_003421329.1.25761 WP_003421329.1.26024 WP_003421329.1.26358 WP_003421329.1.26482 WP_003421329.1.26494 WP_003421329.1.26697 WP_003421329.1.26940 WP_003421329.1.27300 WP_003421329.1.27563 WP_003421329.1.27708 WP_003421329.1.27824 WP_003421329.1.27872 WP_003421329.1.27881 WP_003421329.1.27890 WP_003421329.1.27967 WP_003421329.1.27996 WP_003421329.1.28055 WP_003421329.1.28410 WP_003421329.1.28638 WP_003421329.1.28715 WP_003421329.1.28856 WP_003421329.1.28882 WP_003421329.1.28890 WP_003421329.1.28930 WP_003421329.1.293 WP_003421329.1.29600 WP_003421329.1.29757 WP_003421329.1.29891 WP_003421329.1.29939 WP_003421329.1.3024 WP_003421329.1.3031 WP_003421329.1.30420 WP_003421329.1.30431 WP_003421329.1.30463 WP_003421329.1.30521 WP_003421329.1.30743 WP_003421329.1.30841 WP_003421329.1.30953 WP_003421329.1.31203 WP_003421329.1.31292 WP_003421329.1.31309 WP_003421329.1.31453 WP_003421329.1.31477 WP_003421329.1.31637 WP_003421329.1.31969 WP_003421329.1.32008 WP_003421329.1.32066 WP_003421329.1.32166 WP_003421329.1.32197 WP_003421329.1.32218 WP_003421329.1.32294 WP_003421329.1.32769 WP_003421329.1.32776 WP_003421329.1.32842 WP_003421329.1.32953 WP_003421329.1.33056 WP_003421329.1.33098 WP_003421329.1.33275 WP_003421329.1.33298 WP_003421329.1.33332 WP_003421329.1.33349 WP_003421329.1.3340 WP_003421329.1.33514 WP_003421329.1.33810 WP_003421329.1.34388 WP_003421329.1.34489 WP_003421329.1.34545 WP_003421329.1.34641 WP_003421329.1.34800 WP_003421329.1.34985 WP_003421329.1.35 WP_003421329.1.35002 WP_003421329.1.35137 WP_003421329.1.35187 WP_003421329.1.35234 WP_003421329.1.3559 WP_003421329.1.35709 WP_003421329.1.35832 WP_003421329.1.35884 WP_003421329.1.36078 WP_003421329.1.36257 WP_003421329.1.36738 WP_003421329.1.36835 WP_003421329.1.37255 WP_003421329.1.374 WP_003421329.1.37493 WP_003421329.1.37532 WP_003421329.1.37597 WP_003421329.1.37861 WP_003421329.1.37957 WP_003421329.1.37981 WP_003421329.1.38305 WP_003421329.1.38338 WP_003421329.1.38775 WP_003421329.1.38814 WP_003421329.1.38874 WP_003421329.1.38924 WP_003421329.1.38986 WP_003421329.1.3913 WP_003421329.1.39213 WP_003421329.1.39350 WP_003421329.1.39382 WP_003421329.1.39442 WP_003421329.1.39621 WP_003421329.1.39874 WP_003421329.1.40030 WP_003421329.1.40294 WP_003421329.1.40313 WP_003421329.1.40447 WP_003421329.1.40516 WP_003421329.1.40557 WP_003421329.1.407 WP_003421329.1.40775 WP_003421329.1.40891 WP_003421329.1.40959 WP_003421329.1.40966 WP_003421329.1.41131 WP_003421329.1.4121 WP_003421329.1.41334 WP_003421329.1.4137 WP_003421329.1.41506 WP_003421329.1.41641 WP_003421329.1.41687 WP_003421329.1.41818 WP_003421329.1.41995 WP_003421329.1.42035 WP_003421329.1.4204 WP_003421329.1.42066 WP_003421329.1.42532 WP_003421329.1.42533 WP_003421329.1.42610 WP_003421329.1.43112 WP_003421329.1.4315 WP_003421329.1.4321 WP_003421329.1.43388 WP_003421329.1.43490 WP_003421329.1.43519 WP_003421329.1.43579 WP_003421329.1.43824 WP_003421329.1.4383 WP_003421329.1.44030 WP_003421329.1.44105 WP_003421329.1.44149 WP_003421329.1.44198 WP_003421329.1.44241 WP_003421329.1.44470 WP_003421329.1.44729 WP_003421329.1.45017 WP_003421329.1.45059 WP_003421329.1.45142 WP_003421329.1.45209 WP_003421329.1.45352 WP_003421329.1.45554 WP_003421329.1.4573 WP_003421329.1.45938 WP_003421329.1.45986 WP_003421329.1.46117 WP_003421329.1.46274 WP_003421329.1.46280 WP_003421329.1.46305 WP_003421329.1.4698 WP_003421329.1.47016 WP_003421329.1.47227 WP_003421329.1.47228 WP_003421329.1.47479 WP_003421329.1.47615 WP_003421329.1.47708 WP_003421329.1.47729 WP_003421329.1.47940 WP_003421329.1.48220 WP_003421329.1.48246 WP_003421329.1.4835 WP_003421329.1.48491 WP_003421329.1.48733 WP_003421329.1.48746 WP_003421329.1.48772 WP_003421329.1.48983 WP_003421329.1.48991 WP_003421329.1.49020 WP_003421329.1.49054 WP_003421329.1.49065 WP_003421329.1.4908 WP_003421329.1.49092 WP_003421329.1.49230 WP_003421329.1.49310 WP_003421329.1.49339 WP_003421329.1.49451 WP_003421329.1.4948 WP_003421329.1.49633 WP_003421329.1.50159 WP_003421329.1.50341 WP_003421329.1.50495 WP_003421329.1.5073 WP_003421329.1.50865 WP_003421329.1.51007 WP_003421329.1.51166 WP_003421329.1.51235 WP_003421329.1.51675 WP_003421329.1.51996 WP_003421329.1.52073 WP_003421329.1.52164 WP_003421329.1.52278 WP_003421329.1.52311 WP_003421329.1.52330 WP_003421329.1.52383 WP_003421329.1.52466 WP_003421329.1.52525 WP_003421329.1.52789 WP_003421329.1.52958 WP_003421329.1.52997 WP_003421329.1.53008 WP_003421329.1.53055 WP_003421329.1.53288 WP_003421329.1.5337 WP_003421329.1.53504 WP_003421329.1.53987 WP_003421329.1.54058 WP_003421329.1.54153 WP_003421329.1.54350 WP_003421329.1.54586 WP_003421329.1.55055 WP_003421329.1.55101 WP_003421329.1.5521 WP_003421329.1.55302 WP_003421329.1.55371 WP_003421329.1.55391 WP_003421329.1.559 WP_003421329.1.56006 WP_003421329.1.56252 WP_003421329.1.56323 WP_003421329.1.56337 WP_003421329.1.56556 WP_003421329.1.5657 WP_003421329.1.5664 WP_003421329.1.56664 WP_003421329.1.56711 WP_003421329.1.56754 WP_003421329.1.56927 WP_003421329.1.56998 WP_003421329.1.5750 WP_003421329.1.58015 WP_003421329.1.58216 WP_003421329.1.58304 WP_003421329.1.58315 WP_003421329.1.58463 WP_003421329.1.58531 WP_003421329.1.58665 WP_003421329.1.58677 WP_003421329.1.58818 WP_003421329.1.58956 WP_003421329.1.5905 WP_003421329.1.59618 WP_003421329.1.59628 WP_003421329.1.59752 WP_003421329.1.59990 WP_003421329.1.6031 WP_003421329.1.60482 WP_003421329.1.60563 WP_003421329.1.6070 WP_003421329.1.60957 WP_003421329.1.60998 WP_003421329.1.61042 WP_003421329.1.61140 WP_003421329.1.61293 WP_003421329.1.61716 WP_003421329.1.61866 WP_003421329.1.62049 WP_003421329.1.62095 WP_003421329.1.62128 WP_003421329.1.62577 WP_003421329.1.62624 WP_003421329.1.62797 WP_003421329.1.62941 WP_003421329.1.62986 WP_003421329.1.63020 WP_003421329.1.63059 WP_003421329.1.63239 WP_003421329.1.63343 WP_003421329.1.63378 WP_003421329.1.63516 WP_003421329.1.63570 WP_003421329.1.63598 WP_003421329.1.63696 WP_003421329.1.63852 WP_003421329.1.63950 WP_003421329.1.64020 WP_003421329.1.64092 WP_003421329.1.64369 WP_003421329.1.64546 WP_003421329.1.64573 WP_003421329.1.64859 WP_003421329.1.65064 WP_003421329.1.65067 WP_003421329.1.65313 WP_003421329.1.65369 WP_003421329.1.65889 WP_003421329.1.66084 WP_003421329.1.66237 WP_003421329.1.66439 WP_003421329.1.66474 WP_003421329.1.66565 WP_003421329.1.66587 WP_003421329.1.66608 WP_003421329.1.66643 WP_003421329.1.66701 WP_003421329.1.66805 WP_003421329.1.66847 WP_003421329.1.6685 WP_003421329.1.66887 WP_003421329.1.67303 WP_003421329.1.67308 WP_003421329.1.67368 WP_003421329.1.67689 WP_003421329.1.67711 WP_003421329.1.6792 WP_003421329.1.67951 WP_003421329.1.68150 WP_003421329.1.68980 WP_003421329.1.69114 WP_003421329.1.692 WP_003421329.1.69220 WP_003421329.1.69333 WP_003421329.1.69708 WP_003421329.1.6994 WP_003421329.1.70179 WP_003421329.1.70231 WP_003421329.1.70320 WP_003421329.1.70464 WP_003421329.1.70695 WP_003421329.1.70710 WP_003421329.1.70886 WP_003421329.1.71079 WP_003421329.1.71119 WP_003421329.1.713 WP_003421329.1.71384 WP_003421329.1.71477 WP_003421329.1.7156 WP_003421329.1.7199 WP_003421329.1.72113 WP_003421329.1.72245 WP_003421329.1.72468 WP_003421329.1.72483 WP_003421329.1.72560 WP_003421329.1.72891 WP_003421329.1.72914 WP_003421329.1.72994 WP_003421329.1.73026 WP_003421329.1.73116 WP_003421329.1.73836 WP_003421329.1.73852 WP_003421329.1.74126 WP_003421329.1.74672 WP_003421329.1.74678 WP_003421329.1.74779 WP_003421329.1.74835 WP_003421329.1.74897 WP_003421329.1.75026 WP_003421329.1.75210 WP_003421329.1.75226 WP_003421329.1.75454 WP_003421329.1.75638 WP_003421329.1.75659 WP_003421329.1.76207 WP_003421329.1.76550 WP_003421329.1.76552 WP_003421329.1.76603 WP_003421329.1.76621 WP_003421329.1.76664 WP_003421329.1.76793 WP_003421329.1.76882 WP_003421329.1.7696 WP_003421329.1.77092 WP_003421329.1.77102 WP_003421329.1.77473 WP_003421329.1.77509 WP_003421329.1.77544 WP_003421329.1.77639 WP_003421329.1.77842 WP_003421329.1.77942 WP_003421329.1.78123 WP_003421329.1.78579 WP_003421329.1.78949 WP_003421329.1.79125 WP_003421329.1.7916 WP_003421329.1.79221 WP_003421329.1.79309 WP_003421329.1.79344 WP_003421329.1.79437 WP_003421329.1.79673 WP_003421329.1.79680 WP_003421329.1.79703 WP_003421329.1.79836 WP_003421329.1.80052 WP_003421329.1.80144 WP_003421329.1.80342 WP_003421329.1.80379 WP_003421329.1.80455 WP_003421329.1.80504 WP_003421329.1.80575 WP_003421329.1.80610 WP_003421329.1.80963 WP_003421329.1.81035 WP_003421329.1.81044 WP_003421329.1.81299 WP_003421329.1.81351 WP_003421329.1.81402 WP_003421329.1.81605 WP_003421329.1.81777 WP_003421329.1.82084 WP_003421329.1.82169 WP_003421329.1.82635 WP_003421329.1.82701 WP_003421329.1.82920 WP_003421329.1.8314 WP_003421329.1.83148 WP_003421329.1.83175 WP_003421329.1.83255 WP_003421329.1.83287 WP_003421329.1.83288 WP_003421329.1.83318 WP_003421329.1.83348 WP_003421329.1.8336 WP_003421329.1.834 WP_003421329.1.83477 WP_003421329.1.83641 WP_003421329.1.83822 WP_003421329.1.84195 WP_003421329.1.84253 WP_003421329.1.84528 WP_003421329.1.84606 WP_003421329.1.84646 WP_003421329.1.84923 WP_003421329.1.85020 WP_003421329.1.85127 WP_003421329.1.85214 WP_003421329.1.85219 WP_003421329.1.85420 WP_003421329.1.85454 WP_003421329.1.85776 WP_003421329.1.85863 WP_003421329.1.8587 WP_003421329.1.85874 WP_003421329.1.85932 WP_003421329.1.86008 WP_003421329.1.86011 WP_003421329.1.86049 WP_003421329.1.86088 WP_003421329.1.86094 WP_003421329.1.86116 WP_003421329.1.86117 WP_003421329.1.86743 WP_003421329.1.86767 WP_003421329.1.86837 WP_003421329.1.86914 WP_003421329.1.87195 WP_003421329.1.87326 WP_003421329.1.87714 WP_003421329.1.87723 WP_003421329.1.87918 WP_003421329.1.88091 WP_003421329.1.882 WP_003421329.1.88268 WP_003421329.1.88332 WP_003421329.1.88364 WP_003421329.1.88608 WP_003421329.1.88996 WP_003421329.1.89052 WP_003421329.1.89065 WP_003421329.1.89196 WP_003421329.1.89364 WP_003421329.1.89457 WP_003421329.1.89629 WP_003421329.1.89697 WP_003421329.1.8984 WP_003421329.1.89994 WP_003421329.1.90101 WP_003421329.1.90164 WP_003421329.1.90329 WP_003421329.1.90491 WP_003421329.1.90555 WP_003421329.1.90643 WP_003421329.1.9083 WP_003421329.1.90921 WP_003421329.1.90938 WP_003421329.1.90981 WP_003421329.1.90985 WP_003421329.1.91254 WP_003421329.1.91314 WP_003421329.1.91648 WP_003421329.1.92075 WP_003421329.1.92284 WP_003421329.1.92371 WP_003421329.1.92576 WP_003421329.1.92697 WP_003421329.1.93044 WP_003421329.1.93171 WP_003421329.1.93313 WP_003421329.1.93480 WP_003421329.1.93615 WP_003421329.1.93687 WP_003421329.1.93717 WP_003421329.1.93766 WP_003421329.1.93782 WP_003421329.1.93798 WP_003421329.1.93802 WP_003421329.1.93830 WP_003421329.1.9393 WP_003421329.1.93968 WP_003421329.1.94067 WP_003421329.1.94073 WP_003421329.1.94166 WP_003421329.1.94427 WP_003421329.1.94768 WP_003421329.1.94968 WP_003421329.1.95095 WP_003421329.1.95173 WP_003421329.1.95350 WP_003421329.1.95517 WP_003421329.1.95847 WP_003421329.1.95893 WP_003421329.1.96113 WP_003421329.1.9635 WP_003421329.1.96503 WP_003421329.1.96505 WP_003421329.1.9666 WP_003421329.1.96690 WP_003421329.1.97219 WP_003421329.1.97432 WP_003421329.1.97458 WP_003421329.1.97672 WP_003421329.1.97682 WP_003421329.1.97806 WP_003421329.1.98037 WP_003421329.1.98514 WP_003421329.1.98698 WP_003421329.1.98715 WP_003421329.1.98856 WP_003421329.1.98997 WP_003421329.1.99064 WP_003421329.1.99134 WP_003421329.1.99333 WP_003421329.1.99542 WP_003421329.1.99545 WP_003421329.1.9986 YP_001089965.1.32744 gi|126701068|ref|YP_001089965.1| 272563.CD3445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]