SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126701285|ref|YP_001090182.1| from Clostridium difficile 630

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126701285|ref|YP_001090182.1|
Domain Number 1 Region: 57-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 3.92e-25
Family Ribosomal protein L9 C-domain 0.00015
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.29e-16
Family Ribosomal protein L9 N-domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126701285|ref|YP_001090182.1|
Sequence length 149
Comment 50S ribosomal protein L9 [Clostridium difficile 630]
Sequence
MKVILLKDVKGTGKKGEMKEVSDGYARNFLFPKKMAVQADSVAIKELNEKNKSKEIKAQK
EYEEAVLLGKQMEEINIEIYSKAGEGGRLFGSITSKEIAEQLKKQKDIDVDKRKILLDEP
IRSLGSTFVEIKIHQKVTTKIRVDVKEKQ
Download sequence
Identical sequences A0A031WI13 A0A0H3N768 A0A0J0U865 A0A125YED3 A0A1F2DK99 C9YSE9 G6B9K7 G6BJ53 Q181R0 T4IP28
gi|260688858|ref|YP_003219992.1| gi|126701285|ref|YP_001090182.1| gi|384362886|ref|YP_006200738.1| gi|260685199|ref|YP_003216484.1| 272563.CD3658 645462.CD196_3471 645463.CDR20291_3517 WP_003429267.1.100055 WP_003429267.1.100097 WP_003429267.1.100099 WP_003429267.1.100107 WP_003429267.1.100118 WP_003429267.1.100139 WP_003429267.1.100513 WP_003429267.1.100570 WP_003429267.1.100660 WP_003429267.1.100831 WP_003429267.1.100923 WP_003429267.1.100977 WP_003429267.1.101035 WP_003429267.1.101125 WP_003429267.1.101279 WP_003429267.1.10130 WP_003429267.1.101316 WP_003429267.1.101532 WP_003429267.1.101861 WP_003429267.1.101929 WP_003429267.1.102031 WP_003429267.1.102074 WP_003429267.1.102095 WP_003429267.1.10483 WP_003429267.1.10488 WP_003429267.1.10582 WP_003429267.1.10691 WP_003429267.1.10793 WP_003429267.1.10795 WP_003429267.1.11025 WP_003429267.1.11224 WP_003429267.1.11278 WP_003429267.1.11320 WP_003429267.1.11398 WP_003429267.1.1167 WP_003429267.1.1179 WP_003429267.1.11937 WP_003429267.1.12066 WP_003429267.1.12169 WP_003429267.1.12385 WP_003429267.1.1254 WP_003429267.1.12629 WP_003429267.1.12632 WP_003429267.1.12659 WP_003429267.1.1273 WP_003429267.1.12734 WP_003429267.1.12807 WP_003429267.1.12809 WP_003429267.1.12953 WP_003429267.1.13040 WP_003429267.1.13251 WP_003429267.1.13273 WP_003429267.1.13398 WP_003429267.1.13418 WP_003429267.1.13730 WP_003429267.1.13841 WP_003429267.1.13859 WP_003429267.1.14045 WP_003429267.1.141 WP_003429267.1.14170 WP_003429267.1.14177 WP_003429267.1.14205 WP_003429267.1.1422 WP_003429267.1.14259 WP_003429267.1.14330 WP_003429267.1.14352 WP_003429267.1.1445 WP_003429267.1.14457 WP_003429267.1.14483 WP_003429267.1.14579 WP_003429267.1.14674 WP_003429267.1.14686 WP_003429267.1.14698 WP_003429267.1.14848 WP_003429267.1.1494 WP_003429267.1.15083 WP_003429267.1.15097 WP_003429267.1.15192 WP_003429267.1.15205 WP_003429267.1.15310 WP_003429267.1.15435 WP_003429267.1.15908 WP_003429267.1.16012 WP_003429267.1.16135 WP_003429267.1.16185 WP_003429267.1.16190 WP_003429267.1.16376 WP_003429267.1.16520 WP_003429267.1.16728 WP_003429267.1.16897 WP_003429267.1.169 WP_003429267.1.16931 WP_003429267.1.16966 WP_003429267.1.1705 WP_003429267.1.17371 WP_003429267.1.17413 WP_003429267.1.17463 WP_003429267.1.17512 WP_003429267.1.17611 WP_003429267.1.17638 WP_003429267.1.17808 WP_003429267.1.17851 WP_003429267.1.17879 WP_003429267.1.17908 WP_003429267.1.17960 WP_003429267.1.18060 WP_003429267.1.18207 WP_003429267.1.18212 WP_003429267.1.18298 WP_003429267.1.1838 WP_003429267.1.18407 WP_003429267.1.18455 WP_003429267.1.18462 WP_003429267.1.18551 WP_003429267.1.18680 WP_003429267.1.18805 WP_003429267.1.18970 WP_003429267.1.19088 WP_003429267.1.19152 WP_003429267.1.1926 WP_003429267.1.19290 WP_003429267.1.1934 WP_003429267.1.19627 WP_003429267.1.19648 WP_003429267.1.19704 WP_003429267.1.19899 WP_003429267.1.19956 WP_003429267.1.1999 WP_003429267.1.2002 WP_003429267.1.20132 WP_003429267.1.20184 WP_003429267.1.20302 WP_003429267.1.20313 WP_003429267.1.20481 WP_003429267.1.20650 WP_003429267.1.20728 WP_003429267.1.20872 WP_003429267.1.20875 WP_003429267.1.20960 WP_003429267.1.21000 WP_003429267.1.21048 WP_003429267.1.21201 WP_003429267.1.21220 WP_003429267.1.21417 WP_003429267.1.21502 WP_003429267.1.21520 WP_003429267.1.21547 WP_003429267.1.21618 WP_003429267.1.21704 WP_003429267.1.21893 WP_003429267.1.22020 WP_003429267.1.22079 WP_003429267.1.22128 WP_003429267.1.22222 WP_003429267.1.22228 WP_003429267.1.22313 WP_003429267.1.22357 WP_003429267.1.22411 WP_003429267.1.22417 WP_003429267.1.22568 WP_003429267.1.22569 WP_003429267.1.22615 WP_003429267.1.22768 WP_003429267.1.22893 WP_003429267.1.22937 WP_003429267.1.23096 WP_003429267.1.23208 WP_003429267.1.23287 WP_003429267.1.23338 WP_003429267.1.2363 WP_003429267.1.24197 WP_003429267.1.24457 WP_003429267.1.24520 WP_003429267.1.24826 WP_003429267.1.24889 WP_003429267.1.24900 WP_003429267.1.24987 WP_003429267.1.25128 WP_003429267.1.25416 WP_003429267.1.25761 WP_003429267.1.26024 WP_003429267.1.26044 WP_003429267.1.26358 WP_003429267.1.26482 WP_003429267.1.26494 WP_003429267.1.26697 WP_003429267.1.26829 WP_003429267.1.26940 WP_003429267.1.27563 WP_003429267.1.2758 WP_003429267.1.27677 WP_003429267.1.27708 WP_003429267.1.27824 WP_003429267.1.27872 WP_003429267.1.27881 WP_003429267.1.27890 WP_003429267.1.27967 WP_003429267.1.27989 WP_003429267.1.27996 WP_003429267.1.28055 WP_003429267.1.28410 WP_003429267.1.28638 WP_003429267.1.28715 WP_003429267.1.28856 WP_003429267.1.28882 WP_003429267.1.28890 WP_003429267.1.28930 WP_003429267.1.2923 WP_003429267.1.293 WP_003429267.1.29600 WP_003429267.1.29757 WP_003429267.1.2982 WP_003429267.1.29891 WP_003429267.1.3024 WP_003429267.1.303 WP_003429267.1.3031 WP_003429267.1.30420 WP_003429267.1.30431 WP_003429267.1.30463 WP_003429267.1.30519 WP_003429267.1.30521 WP_003429267.1.30743 WP_003429267.1.30841 WP_003429267.1.30953 WP_003429267.1.31160 WP_003429267.1.31183 WP_003429267.1.31203 WP_003429267.1.31292 WP_003429267.1.31309 WP_003429267.1.31351 WP_003429267.1.31385 WP_003429267.1.31453 WP_003429267.1.31475 WP_003429267.1.31477 WP_003429267.1.31519 WP_003429267.1.31637 WP_003429267.1.31719 WP_003429267.1.31742 WP_003429267.1.31960 WP_003429267.1.31969 WP_003429267.1.32008 WP_003429267.1.32066 WP_003429267.1.32119 WP_003429267.1.32166 WP_003429267.1.32197 WP_003429267.1.32218 WP_003429267.1.32230 WP_003429267.1.32294 WP_003429267.1.32699 WP_003429267.1.32769 WP_003429267.1.32776 WP_003429267.1.32842 WP_003429267.1.33056 WP_003429267.1.33098 WP_003429267.1.33164 WP_003429267.1.33298 WP_003429267.1.33332 WP_003429267.1.33349 WP_003429267.1.3340 WP_003429267.1.33514 WP_003429267.1.33810 WP_003429267.1.34388 WP_003429267.1.34489 WP_003429267.1.34545 WP_003429267.1.34641 WP_003429267.1.34800 WP_003429267.1.34985 WP_003429267.1.34989 WP_003429267.1.35 WP_003429267.1.35002 WP_003429267.1.35137 WP_003429267.1.35181 WP_003429267.1.35187 WP_003429267.1.35234 WP_003429267.1.3559 WP_003429267.1.35709 WP_003429267.1.35832 WP_003429267.1.35884 WP_003429267.1.36078 WP_003429267.1.36257 WP_003429267.1.36338 WP_003429267.1.36738 WP_003429267.1.36835 WP_003429267.1.37255 WP_003429267.1.374 WP_003429267.1.37493 WP_003429267.1.37532 WP_003429267.1.37597 WP_003429267.1.37861 WP_003429267.1.3789 WP_003429267.1.37957 WP_003429267.1.37981 WP_003429267.1.38305 WP_003429267.1.38338 WP_003429267.1.38692 WP_003429267.1.38775 WP_003429267.1.38814 WP_003429267.1.38874 WP_003429267.1.38924 WP_003429267.1.38986 WP_003429267.1.39008 WP_003429267.1.3913 WP_003429267.1.39213 WP_003429267.1.39350 WP_003429267.1.39382 WP_003429267.1.39442 WP_003429267.1.39525 WP_003429267.1.39621 WP_003429267.1.39783 WP_003429267.1.39874 WP_003429267.1.39876 WP_003429267.1.39975 WP_003429267.1.39981 WP_003429267.1.40030 WP_003429267.1.40294 WP_003429267.1.40313 WP_003429267.1.40447 WP_003429267.1.40522 WP_003429267.1.40557 WP_003429267.1.407 WP_003429267.1.40775 WP_003429267.1.40891 WP_003429267.1.40959 WP_003429267.1.40966 WP_003429267.1.41131 WP_003429267.1.4121 WP_003429267.1.41334 WP_003429267.1.41342 WP_003429267.1.4137 WP_003429267.1.41506 WP_003429267.1.41534 WP_003429267.1.41641 WP_003429267.1.41687 WP_003429267.1.41818 WP_003429267.1.41995 WP_003429267.1.42035 WP_003429267.1.4204 WP_003429267.1.42066 WP_003429267.1.42532 WP_003429267.1.42533 WP_003429267.1.42610 WP_003429267.1.42664 WP_003429267.1.43112 WP_003429267.1.4315 WP_003429267.1.4321 WP_003429267.1.43388 WP_003429267.1.43490 WP_003429267.1.43519 WP_003429267.1.43579 WP_003429267.1.43663 WP_003429267.1.43824 WP_003429267.1.4383 WP_003429267.1.44030 WP_003429267.1.44105 WP_003429267.1.44149 WP_003429267.1.44198 WP_003429267.1.44241 WP_003429267.1.44470 WP_003429267.1.44471 WP_003429267.1.44729 WP_003429267.1.45017 WP_003429267.1.45059 WP_003429267.1.45142 WP_003429267.1.45165 WP_003429267.1.45209 WP_003429267.1.45257 WP_003429267.1.45352 WP_003429267.1.45554 WP_003429267.1.4573 WP_003429267.1.45938 WP_003429267.1.45986 WP_003429267.1.46066 WP_003429267.1.46274 WP_003429267.1.46280 WP_003429267.1.46305 WP_003429267.1.46522 WP_003429267.1.4698 WP_003429267.1.47016 WP_003429267.1.47121 WP_003429267.1.47227 WP_003429267.1.47228 WP_003429267.1.47479 WP_003429267.1.47615 WP_003429267.1.47708 WP_003429267.1.47729 WP_003429267.1.47940 WP_003429267.1.48220 WP_003429267.1.48246 WP_003429267.1.48279 WP_003429267.1.4835 WP_003429267.1.48733 WP_003429267.1.48746 WP_003429267.1.48772 WP_003429267.1.48935 WP_003429267.1.48980 WP_003429267.1.48983 WP_003429267.1.48991 WP_003429267.1.49020 WP_003429267.1.49054 WP_003429267.1.49065 WP_003429267.1.4908 WP_003429267.1.49092 WP_003429267.1.49230 WP_003429267.1.49310 WP_003429267.1.49339 WP_003429267.1.4948 WP_003429267.1.49633 WP_003429267.1.50159 WP_003429267.1.50341 WP_003429267.1.50460 WP_003429267.1.5073 WP_003429267.1.50865 WP_003429267.1.51007 WP_003429267.1.51235 WP_003429267.1.51675 WP_003429267.1.51996 WP_003429267.1.52073 WP_003429267.1.52266 WP_003429267.1.52278 WP_003429267.1.52294 WP_003429267.1.52311 WP_003429267.1.52330 WP_003429267.1.52383 WP_003429267.1.52402 WP_003429267.1.52466 WP_003429267.1.52525 WP_003429267.1.52789 WP_003429267.1.52958 WP_003429267.1.52997 WP_003429267.1.53008 WP_003429267.1.53044 WP_003429267.1.53055 WP_003429267.1.5337 WP_003429267.1.53504 WP_003429267.1.53704 WP_003429267.1.53710 WP_003429267.1.53729 WP_003429267.1.53987 WP_003429267.1.54058 WP_003429267.1.54153 WP_003429267.1.5423 WP_003429267.1.54262 WP_003429267.1.54350 WP_003429267.1.54586 WP_003429267.1.54593 WP_003429267.1.54692 WP_003429267.1.55055 WP_003429267.1.55101 WP_003429267.1.5521 WP_003429267.1.55302 WP_003429267.1.55371 WP_003429267.1.55391 WP_003429267.1.5558 WP_003429267.1.559 WP_003429267.1.56006 WP_003429267.1.56217 WP_003429267.1.56252 WP_003429267.1.56323 WP_003429267.1.56337 WP_003429267.1.56556 WP_003429267.1.5657 WP_003429267.1.5661 WP_003429267.1.5664 WP_003429267.1.56664 WP_003429267.1.56711 WP_003429267.1.56754 WP_003429267.1.56927 WP_003429267.1.56998 WP_003429267.1.57099 WP_003429267.1.57337 WP_003429267.1.5750 WP_003429267.1.57711 WP_003429267.1.57827 WP_003429267.1.58015 WP_003429267.1.58216 WP_003429267.1.58304 WP_003429267.1.58315 WP_003429267.1.58323 WP_003429267.1.58463 WP_003429267.1.58531 WP_003429267.1.58665 WP_003429267.1.58677 WP_003429267.1.58711 WP_003429267.1.58818 WP_003429267.1.58956 WP_003429267.1.59032 WP_003429267.1.5905 WP_003429267.1.59588 WP_003429267.1.59618 WP_003429267.1.59628 WP_003429267.1.59707 WP_003429267.1.59752 WP_003429267.1.59990 WP_003429267.1.60040 WP_003429267.1.6031 WP_003429267.1.60482 WP_003429267.1.60563 WP_003429267.1.6070 WP_003429267.1.60957 WP_003429267.1.60998 WP_003429267.1.61042 WP_003429267.1.61140 WP_003429267.1.61293 WP_003429267.1.61492 WP_003429267.1.61679 WP_003429267.1.61716 WP_003429267.1.61866 WP_003429267.1.61972 WP_003429267.1.62049 WP_003429267.1.62095 WP_003429267.1.62128 WP_003429267.1.62340 WP_003429267.1.62577 WP_003429267.1.62624 WP_003429267.1.62637 WP_003429267.1.62941 WP_003429267.1.62986 WP_003429267.1.63020 WP_003429267.1.63059 WP_003429267.1.63237 WP_003429267.1.63239 WP_003429267.1.63248 WP_003429267.1.63343 WP_003429267.1.63378 WP_003429267.1.63516 WP_003429267.1.63570 WP_003429267.1.63581 WP_003429267.1.63598 WP_003429267.1.63599 WP_003429267.1.63696 WP_003429267.1.63804 WP_003429267.1.63853 WP_003429267.1.63950 WP_003429267.1.64020 WP_003429267.1.64092 WP_003429267.1.64197 WP_003429267.1.64369 WP_003429267.1.64447 WP_003429267.1.64546 WP_003429267.1.64573 WP_003429267.1.64859 WP_003429267.1.65064 WP_003429267.1.65067 WP_003429267.1.65313 WP_003429267.1.65369 WP_003429267.1.65889 WP_003429267.1.66084 WP_003429267.1.66119 WP_003429267.1.66237 WP_003429267.1.66439 WP_003429267.1.66474 WP_003429267.1.66565 WP_003429267.1.66587 WP_003429267.1.66608 WP_003429267.1.66643 WP_003429267.1.66701 WP_003429267.1.6671 WP_003429267.1.6675 WP_003429267.1.66805 WP_003429267.1.66847 WP_003429267.1.6685 WP_003429267.1.66887 WP_003429267.1.66888 WP_003429267.1.66900 WP_003429267.1.670 WP_003429267.1.67303 WP_003429267.1.67308 WP_003429267.1.6736 WP_003429267.1.67368 WP_003429267.1.67528 WP_003429267.1.67689 WP_003429267.1.67695 WP_003429267.1.67711 WP_003429267.1.6792 WP_003429267.1.67951 WP_003429267.1.68150 WP_003429267.1.68276 WP_003429267.1.68322 WP_003429267.1.68955 WP_003429267.1.6898 WP_003429267.1.68980 WP_003429267.1.69114 WP_003429267.1.692 WP_003429267.1.69220 WP_003429267.1.69333 WP_003429267.1.69495 WP_003429267.1.69708 WP_003429267.1.6994 WP_003429267.1.700 WP_003429267.1.70152 WP_003429267.1.70179 WP_003429267.1.70231 WP_003429267.1.70320 WP_003429267.1.70695 WP_003429267.1.70710 WP_003429267.1.70820 WP_003429267.1.70886 WP_003429267.1.71079 WP_003429267.1.71119 WP_003429267.1.713 WP_003429267.1.71384 WP_003429267.1.71477 WP_003429267.1.7156 WP_003429267.1.71745 WP_003429267.1.7199 WP_003429267.1.72113 WP_003429267.1.72245 WP_003429267.1.72468 WP_003429267.1.72483 WP_003429267.1.72560 WP_003429267.1.72682 WP_003429267.1.72891 WP_003429267.1.72909 WP_003429267.1.72914 WP_003429267.1.72994 WP_003429267.1.73026 WP_003429267.1.73116 WP_003429267.1.7322 WP_003429267.1.73605 WP_003429267.1.73836 WP_003429267.1.73852 WP_003429267.1.73931 WP_003429267.1.74050 WP_003429267.1.74116 WP_003429267.1.74126 WP_003429267.1.74672 WP_003429267.1.74678 WP_003429267.1.74680 WP_003429267.1.74779 WP_003429267.1.74835 WP_003429267.1.74897 WP_003429267.1.75026 WP_003429267.1.751 WP_003429267.1.75210 WP_003429267.1.75226 WP_003429267.1.75287 WP_003429267.1.75454 WP_003429267.1.75638 WP_003429267.1.75659 WP_003429267.1.76207 WP_003429267.1.7650 WP_003429267.1.76550 WP_003429267.1.76552 WP_003429267.1.76603 WP_003429267.1.76621 WP_003429267.1.76664 WP_003429267.1.76687 WP_003429267.1.76793 WP_003429267.1.76813 WP_003429267.1.76882 WP_003429267.1.76924 WP_003429267.1.7696 WP_003429267.1.77092 WP_003429267.1.77102 WP_003429267.1.77473 WP_003429267.1.77509 WP_003429267.1.77544 WP_003429267.1.7755 WP_003429267.1.77639 WP_003429267.1.77782 WP_003429267.1.77842 WP_003429267.1.77942 WP_003429267.1.78123 WP_003429267.1.78579 WP_003429267.1.78949 WP_003429267.1.7916 WP_003429267.1.79199 WP_003429267.1.79221 WP_003429267.1.79309 WP_003429267.1.79344 WP_003429267.1.79437 WP_003429267.1.79611 WP_003429267.1.79680 WP_003429267.1.79703 WP_003429267.1.79836 WP_003429267.1.79956 WP_003429267.1.80052 WP_003429267.1.80144 WP_003429267.1.80342 WP_003429267.1.80379 WP_003429267.1.80455 WP_003429267.1.80504 WP_003429267.1.80575 WP_003429267.1.80963 WP_003429267.1.81035 WP_003429267.1.81044 WP_003429267.1.81208 WP_003429267.1.81299 WP_003429267.1.81351 WP_003429267.1.81402 WP_003429267.1.81605 WP_003429267.1.81777 WP_003429267.1.82002 WP_003429267.1.82084 WP_003429267.1.82150 WP_003429267.1.82169 WP_003429267.1.82335 WP_003429267.1.82635 WP_003429267.1.82701 WP_003429267.1.82920 WP_003429267.1.8314 WP_003429267.1.83148 WP_003429267.1.83175 WP_003429267.1.83255 WP_003429267.1.83287 WP_003429267.1.83288 WP_003429267.1.83318 WP_003429267.1.83348 WP_003429267.1.8336 WP_003429267.1.834 WP_003429267.1.83477 WP_003429267.1.83515 WP_003429267.1.83822 WP_003429267.1.83918 WP_003429267.1.84253 WP_003429267.1.84528 WP_003429267.1.84646 WP_003429267.1.84843 WP_003429267.1.84880 WP_003429267.1.84923 WP_003429267.1.85020 WP_003429267.1.85127 WP_003429267.1.85214 WP_003429267.1.85219 WP_003429267.1.8527 WP_003429267.1.85420 WP_003429267.1.85442 WP_003429267.1.85454 WP_003429267.1.85776 WP_003429267.1.85863 WP_003429267.1.8587 WP_003429267.1.85874 WP_003429267.1.85932 WP_003429267.1.86008 WP_003429267.1.86011 WP_003429267.1.86049 WP_003429267.1.86088 WP_003429267.1.86094 WP_003429267.1.86116 WP_003429267.1.86117 WP_003429267.1.86328 WP_003429267.1.86395 WP_003429267.1.86534 WP_003429267.1.86618 WP_003429267.1.86743 WP_003429267.1.86767 WP_003429267.1.86837 WP_003429267.1.86914 WP_003429267.1.87058 WP_003429267.1.87195 WP_003429267.1.87326 WP_003429267.1.87454 WP_003429267.1.87714 WP_003429267.1.87723 WP_003429267.1.87730 WP_003429267.1.87918 WP_003429267.1.87932 WP_003429267.1.88091 WP_003429267.1.882 WP_003429267.1.88268 WP_003429267.1.88332 WP_003429267.1.88364 WP_003429267.1.88372 WP_003429267.1.88377 WP_003429267.1.88608 WP_003429267.1.88640 WP_003429267.1.88996 WP_003429267.1.89052 WP_003429267.1.89065 WP_003429267.1.89196 WP_003429267.1.89337 WP_003429267.1.89364 WP_003429267.1.89457 WP_003429267.1.89541 WP_003429267.1.89629 WP_003429267.1.89697 WP_003429267.1.8984 WP_003429267.1.89994 WP_003429267.1.90076 WP_003429267.1.90101 WP_003429267.1.90164 WP_003429267.1.90329 WP_003429267.1.9041 WP_003429267.1.90491 WP_003429267.1.90555 WP_003429267.1.90643 WP_003429267.1.9083 WP_003429267.1.90921 WP_003429267.1.90938 WP_003429267.1.90985 WP_003429267.1.91065 WP_003429267.1.91254 WP_003429267.1.91314 WP_003429267.1.91406 WP_003429267.1.91570 WP_003429267.1.91648 WP_003429267.1.92075 WP_003429267.1.92284 WP_003429267.1.92371 WP_003429267.1.92576 WP_003429267.1.92658 WP_003429267.1.92697 WP_003429267.1.92941 WP_003429267.1.93044 WP_003429267.1.93171 WP_003429267.1.93313 WP_003429267.1.93360 WP_003429267.1.93480 WP_003429267.1.93615 WP_003429267.1.93687 WP_003429267.1.93717 WP_003429267.1.93766 WP_003429267.1.93782 WP_003429267.1.93798 WP_003429267.1.93802 WP_003429267.1.93830 WP_003429267.1.9393 WP_003429267.1.93968 WP_003429267.1.94067 WP_003429267.1.94073 WP_003429267.1.94166 WP_003429267.1.94427 WP_003429267.1.94768 WP_003429267.1.94831 WP_003429267.1.94968 WP_003429267.1.95095 WP_003429267.1.95173 WP_003429267.1.9522 WP_003429267.1.95350 WP_003429267.1.95517 WP_003429267.1.9580 WP_003429267.1.95847 WP_003429267.1.95893 WP_003429267.1.96113 WP_003429267.1.96503 WP_003429267.1.96505 WP_003429267.1.9666 WP_003429267.1.96690 WP_003429267.1.96765 WP_003429267.1.97219 WP_003429267.1.97458 WP_003429267.1.97672 WP_003429267.1.97682 WP_003429267.1.97806 WP_003429267.1.98037 WP_003429267.1.98514 WP_003429267.1.98622 WP_003429267.1.98698 WP_003429267.1.98715 WP_003429267.1.98748 WP_003429267.1.98856 WP_003429267.1.98913 WP_003429267.1.98997 WP_003429267.1.99064 WP_003429267.1.99134 WP_003429267.1.99333 WP_003429267.1.99542 WP_003429267.1.99545 WP_003429267.1.99731 WP_003429267.1.9986 YP_001090182.1.32744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]