SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154173758|ref|YP_001407855.1| from Campylobacter curvus 525.92

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154173758|ref|YP_001407855.1|
Domain Number 1 Region: 44-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.25e-41
Family Myf domain 0.003
Further Details:      
 
Domain Number 2 Region: 461-675
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.08e-28
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00079
Further Details:      
 
Domain Number 3 Region: 682-778
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.27e-24
Family Anticodon-binding domain of PheRS 0.0021
Further Details:      
 
Domain Number 4 Region: 395-469
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000076
Family Domains B1 and B5 of PheRS-beta, PheT 0.0054
Further Details:      
 
Domain Number 5 Region: 225-366
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000288
Family B3/B4 domain of PheRS, PheT 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154173758|ref|YP_001407855.1|
Sequence length 778
Comment phenylalanyl-tRNA synthetase subunit beta [Campylobacter curvus 525.92]
Sequence
MIISKHWLNEWVDISEISGEKLLKTLNSIGLEVDSYKEIKLPDSIVVGYVKNKEKHPDAD
KLNVCQVDVGKETLQIVCGAKNVEAGQFVPVALIGTVMPNGLEIKKAKLRGVESCGMICS
STELGMVKVNDGILPLDESVGNLKLGVSLNEFDVFKDIIIEIDVTANRGDCQSMHGVARE
ICAALDLNLRDNLLYEDADNLLGIGRIVSVRAEDGVRGSFLYRAFEIKSTISENLLTRMR
LALIECKKEGIIERLLDYMSYCTGVLFRAYDFAKLGSDDERIMFDIKNGKNGECVVFCGD
KNLGVAGIYQSDEGRVDESSKLIVLEANYTEPSVIARIIGEDKDLPRGDQIYRSSRGSEP
NLAYGADYFFKRLSNYKDAVGLYAGSQHSILRKEPATINVSLNELKNMIGQEVARNDVVK
ILKKLGFEVGVNVEQESINVKAPSFRHDILNLHDICEEIVRIVGIDNIASTPLVFAEQNR
LMPTYIKYKNSLNLRRKAADCGFFESVHYVFDSLEELGKLGFAPCKVAILNPINNELNTL
RPTLVNHLLNSCERNIKNSKKSVKLFELGEVFDENAKESLRVGFALCGQAKEPSLINGAK
GEEAGFYVFASMVQNVIGKFTLLPDDKISYLSPYEQAIICQNGEKIGYMGRVDIKVQNSH
DLPKTYICEIDFEAMKFNKIEAKPYSKFPSISRDLSLIVPDGFEFAKIYECIRGLNLKEL
KEFLPVDIYRGAGLENSASVSLKFTFQDMDKTLEDEEVGVLMDKILSELKTKLNIGIR
Download sequence
Identical sequences A7GXB3
WP_011992029.1.77152 360105.CCV52592_0517 gi|154173758|ref|YP_001407855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]