SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154173841|ref|YP_001407377.1| from Campylobacter curvus 525.92

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154173841|ref|YP_001407377.1|
Domain Number 1 Region: 1-264
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.67e-29
Family Methylenetetrahydrofolate reductase 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154173841|ref|YP_001407377.1|
Sequence length 311
Comment hypothetical protein CCV52592_0341 [Campylobacter curvus 525.92]
Sequence
MLIQKIKNNEAGILLYGLTPPKENLTDEETATIAAKQIARLEGQNIDGIVLYDLQDESSR
TNEERPFEFIKTTPPETYYETYLKKHFKAVIYKAVGKYDEPEFCEFLRHQQEDFICVFVG
ASSKSQEVKLRLDEAYALKAKFAPNITLGGICIPERHASKLDEHLKVAHKSEKGCEFFIT
QAVYNLENAKKFIDDYAKLEGKKCPIIFTFTPCGSAKTLLFMKWLGINIPPNFEERLNAS
ENILQTSLNLCLEIFNFLYKYGLAKGISVGANVESVSNRKVEIEASITLLKQIQEIIAKT
NTAYHWIGAGV
Download sequence
Identical sequences A7GVY5
360105.CCV52592_0341 WP_011991662.1.77152 gi|154173841|ref|YP_001407377.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]