SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472335368|ref|YP_007667642.1| from Mannheimia haemolytica USDA-ARS-USMARC-185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472335368|ref|YP_007667642.1|
Domain Number 1 Region: 3-166
Classification Level Classification E-value
Superfamily MtlR-like 1.44e-51
Family MtlR-like 0.00006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|472335368|ref|YP_007667642.1|
Sequence length 171
Comment Mannitol operon repressor [Mannheimia haemolytica USDA-ARS-USMARC-185]
Sequence
MMDYIDKLSEETTLRGFLSIANQRFAKAVEQLIERVFRKTDFALKSVVDSLFEHQGPLAD
IEVRLKVLLGLGVISPKVFEDISLFLEVKQHLNEEEDEFAFSHPAVVKFAKDLHHIDFLP
INELLNMKASAANKDSMLFQMQQMRLEKMVRSSLILAVTEIDEQLNVESPL
Download sequence
Identical sequences A0A0B5BNR1 A0A249A2V3 M9X3K8
gi|472335368|ref|YP_007667642.1| gi|482885316|ref|YP_007882489.1| gi|472335187|ref|YP_007667462.1| WP_006250833.1.100578 WP_006250833.1.101281 WP_006250833.1.14651 WP_006250833.1.15850 WP_006250833.1.18032 WP_006250833.1.19836 WP_006250833.1.20456 WP_006250833.1.2132 WP_006250833.1.21690 WP_006250833.1.22107 WP_006250833.1.23336 WP_006250833.1.24300 WP_006250833.1.25136 WP_006250833.1.26880 WP_006250833.1.27302 WP_006250833.1.2785 WP_006250833.1.28573 WP_006250833.1.29735 WP_006250833.1.30596 WP_006250833.1.33793 WP_006250833.1.34159 WP_006250833.1.34894 WP_006250833.1.40079 WP_006250833.1.41844 WP_006250833.1.42410 WP_006250833.1.42606 WP_006250833.1.43708 WP_006250833.1.44810 WP_006250833.1.45083 WP_006250833.1.47009 WP_006250833.1.49314 WP_006250833.1.49495 WP_006250833.1.50719 WP_006250833.1.52776 WP_006250833.1.55804 WP_006250833.1.61638 WP_006250833.1.62250 WP_006250833.1.63192 WP_006250833.1.63974 WP_006250833.1.72771 WP_006250833.1.73398 WP_006250833.1.73864 WP_006250833.1.74727 WP_006250833.1.74925 WP_006250833.1.76946 WP_006250833.1.78880 WP_006250833.1.8019 WP_006250833.1.802 WP_006250833.1.81289 WP_006250833.1.82341 WP_006250833.1.84529 WP_006250833.1.8479 WP_006250833.1.90102 WP_006250833.1.91740 WP_006250833.1.93146 WP_006250833.1.94296 WP_006250833.1.95684 WP_006250833.1.95739 WP_006250833.1.9701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]