SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472336467|ref|YP_007668741.1| from Mannheimia haemolytica USDA-ARS-USMARC-185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472336467|ref|YP_007668741.1|
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily YjgF-like 7.85e-44
Family YjgF/L-PSP 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|472336467|ref|YP_007668741.1|
Sequence length 128
Comment RutC [Mannheimia haemolytica USDA-ARS-USMARC-185]
Sequence
MTVIHTENAPAAIGPYVQAVDLGNMVLTSGQIPVNPETGEIPSDIVQQTRQSLNNVKAII
EQAGLTVADIVKTTVFVKDLNDFAKVNAEYQAFFQENEHPNFPARSCVEVARLPKDVGIE
IEAIAVRR
Download sequence
Identical sequences A0A249A030 E2P5L4 M9WZQ2 S9YAN4
gi|526468760|ref|YP_008338966.1| gi|525655802|ref|YP_008219153.1| gi|472334017|ref|YP_007666292.1| gi|482886745|ref|YP_007883918.1| gi|525701385|ref|YP_008233011.1| WP_006249039.1.100578 WP_006249039.1.101281 WP_006249039.1.14651 WP_006249039.1.15850 WP_006249039.1.18032 WP_006249039.1.19836 WP_006249039.1.20456 WP_006249039.1.2132 WP_006249039.1.21690 WP_006249039.1.22107 WP_006249039.1.23336 WP_006249039.1.24300 WP_006249039.1.25136 WP_006249039.1.26880 WP_006249039.1.2785 WP_006249039.1.28573 WP_006249039.1.29735 WP_006249039.1.30596 WP_006249039.1.33793 WP_006249039.1.34159 WP_006249039.1.34894 WP_006249039.1.39283 WP_006249039.1.40079 WP_006249039.1.41844 WP_006249039.1.42410 WP_006249039.1.42606 WP_006249039.1.43708 WP_006249039.1.44810 WP_006249039.1.45083 WP_006249039.1.47009 WP_006249039.1.49314 WP_006249039.1.49495 WP_006249039.1.50719 WP_006249039.1.52776 WP_006249039.1.55804 WP_006249039.1.61638 WP_006249039.1.62250 WP_006249039.1.63192 WP_006249039.1.63974 WP_006249039.1.72771 WP_006249039.1.73398 WP_006249039.1.73782 WP_006249039.1.73864 WP_006249039.1.74727 WP_006249039.1.74925 WP_006249039.1.76946 WP_006249039.1.78880 WP_006249039.1.8019 WP_006249039.1.802 WP_006249039.1.81289 WP_006249039.1.82341 WP_006249039.1.84529 WP_006249039.1.8479 WP_006249039.1.90102 WP_006249039.1.91740 WP_006249039.1.93146 WP_006249039.1.94296 WP_006249039.1.95684 WP_006249039.1.95739 WP_006249039.1.9701 gi|525662664|ref|YP_008221522.1| gi|472336467|ref|YP_007668741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]