SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153008743|ref|YP_001369958.1| from Ochrobactrum anthropi ATCC 49188

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153008743|ref|YP_001369958.1|
Domain Number 1 Region: 6-317
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.22e-69
Family beta-Lactamase/D-ala carboxypeptidase 0.0000000000647
Further Details:      
 
Domain Number 2 Region: 420-519
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 6.02e-44
Family D-aminopeptidase, middle and C-terminal domains 0.00000396
Further Details:      
 
Domain Number 3 Region: 337-417
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 9.94e-34
Family D-aminopeptidase, middle and C-terminal domains 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153008743|ref|YP_001369958.1|
Sequence length 520
Comment D-aminopeptidase [Ochrobactrum anthropi ATCC 49188]
Sequence
MSKFDLSALETFVRTIPQHYKGPGGAVAVLKDGKVVLRHAWGFADLSTRKAMTPETRMPI
CSVSKQFTCAVLLDSVGEPEVLDDALAAYLDKFAEKRPSVRDLCNNQSGLRDYWALTVLC
GADPEGVFLPEQAQSLLRRLKTTHFAPGTHYSYCNGNFRILADLIEQHTGRSLIELLSER
IFQPAGMKTAELIPDTALFDECTGYEGDTVRGFLPAVNRIHWMGDAGICASLDDMIAWEQ
FIDATRDDESGIYRRLSGLQTFSDGAAAPYGLGLKFEETGGKRLTGHGGALRGWRCQRWH
CADERLSTIAMFNFEGGASDVAFKLMNIALGVPTSEQVRVAADAVWFGSWLDHETGLVLS
LEDAGRGRMKARFGTGPEMMDVVGENEARSSMTAIRRDGDTIHLAREDENLSLTMQRLKG
AAKQDIAGHYRSDELEADLLIVDEGGAFYGAFEGFLGKSDMYSLYEAGPDVWLLPVQRSM
DAPSPGEWKLVFHRDAKGEITGMTVGCWLARHVDYRRIQE
Download sequence
Identical sequences A6WYS5
gi|153008743|ref|YP_001369958.1| WP_012091479.1.12014 WP_012091479.1.91370 439375.Oant_1412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]