SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148257178|ref|YP_001241763.1| from Bradyrhizobium sp. BTAi1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148257178|ref|YP_001241763.1|
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily YccV-like 8.76e-29
Family YccV-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148257178|ref|YP_001241763.1|
Sequence length 108
Comment hypothetical protein BBta_5916 [Bradyrhizobium sp. BTAi1]
Sequence
MVRMEAKFTIGQVTRHRVYDLRGVVFDVDLSFSEEEGWRAITMDARLDKEQPFYYLLAES
GDSSYIAYVPEQNLLPDASGEPVKHPDIGELFDVDDDGSYHYRGRIFQ
Download sequence
Identical sequences A5ENW3
WP_012045812.1.57540 gi|148257178|ref|YP_001241763.1| 288000.BBta_5916 2005389251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]