SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148257255|ref|YP_001241840.1| from Bradyrhizobium sp. BTAi1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148257255|ref|YP_001241840.1|
Domain Number 1 Region: 36-404
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.45e-70
Family L-arabinose binding protein-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148257255|ref|YP_001241840.1|
Sequence length 407
Comment leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein [Bradyrhizobium sp. BTAi1]
Sequence
MTRISKSMSRRTVLKSGVALTSMLAAPGLLRAEPAPVKVGLLQPISGAFALDGDLAKIGA
EFAIKEINDAGGIKALGGAKLELVVGDSRSNAEAGAQATEELQSAGVAAVLGGFASGIAL
TATQTAARYDLPFVVDCAVADTITERGLKNTFRFNPNFSMATAVALKNLVKLNDDAGKPI
KTVAIVHEDGLFGSGLAKIMQEKLPPLGFQIVETIAHPTPARDMTNVVLRLRALNPDLIV
PSHYFNEFVLMARTLQQQRVRPKGIYAVFGGAASSYRFVNEFPEAAQGVMDCNHWGDPKS
PITAKLRETVTAAGKFYAYNTPINYSLVKVFAQAVEKAGSADRAKIIEALAANEFDSGIM
PYGKTKFDAKGQNASALPLNTQVQGKDIKVIYPAEYAEAKPVFPING
Download sequence
Identical sequences A5EP40
gi|148257255|ref|YP_001241840.1| WP_012045885.1.57540 288000.BBta_5995 2005388993 2005291270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]