SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148258751|ref|YP_001243336.1| from Bradyrhizobium sp. BTAi1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148258751|ref|YP_001243336.1|
Domain Number 1 Region: 49-376
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-69
Family L-arabinose binding protein-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148258751|ref|YP_001243336.1|
Sequence length 393
Comment ABC transporter substrate-binding protein [Bradyrhizobium sp. BTAi1]
Sequence
MLSTGSVTAGRPGLPPSLLFRSPPRRGAVPFLAPFDPDRAERRGARNRLRIGNFLTFSGS
PGIWGPAATNSALLAVSEINRRGGILGREIELSFYDSGGAVEDVAARARDALDFDDIDVV
MGSHISAVRLALRRLTRGRIPYVYTPVYEGGERTPGVMAIGETPHSQTRPAIHWLAENKG
AKRWYLIGSDYVWPWQSHLQTKIYIGEAGGHVVGEEFVPVGHDDHEAHLARIRATRPDVV
LISLIGTDSITFNRAFGESGLAATTLRLAGAVDETVLLGIGADNTENLYSASGYFNCIGS
RANDEFMSLYTAMFGVDAPPVGSVGQSNYEGLRFLKAAAERAGSLSLHPLAAAGRNIVYS
GARGEVAIRQGRAGMAMHLAAADGLDFRIIRTF
Download sequence
Identical sequences A5ETD6
288000.BBta_7583 WP_012047321.1.57540 gi|148258751|ref|YP_001243336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]