SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121594093|ref|YP_985989.1| from Acidovorax sp. JS42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121594093|ref|YP_985989.1|
Domain Number 1 Region: 168-439
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 5.1e-60
Family Tricorn protease N-terminal domain 0.0081
Further Details:      
 
Domain Number 2 Region: 48-175
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 7.59e-35
Family TolB, N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121594093|ref|YP_985989.1|
Sequence length 443
Comment translocation protein TolB [Acidovorax sp. JS42]
Sequence
MVPMTIDRIPNTPSFRTALPHLSRRHAIAALAASSPLSALAQFRVEITGVGLTQLPIAIA
PFRGEPQSPQKISAIVQADLERSGRFLGVDASGVALDESSRPDLSLWRQRKADALTSGSI
TRLADGRFDVRFRLWDVVKAQDLGGQSFVVTQADLRLVAHRIADFVYEKLTGERGIFSTR
IAYVTKAGSRYSLWVADADGENAQSALSSPEPIISPAWAPTGTQLAYVSFESRKPVVYVH
DVATGRRRLIANFRGSNSAPAWSPDGRTLAVTLSRDGGSQLYTIDANGGEPRRLMQSSGI
DTEPVFSSDGRSIYFVSDRGGSPQVYRVAASGGGAERVTFNGSYNISPSISPDGQWLAYI
SRVGGAYKLHVMDLKSGSVTAVTDTSADENPSFAPNSRLIVYATQQQGREALMTTTLDGK
IKARLAGQGGDIREPDWGPFQNK
Download sequence
Identical sequences A1W6N8
gi|121594093|ref|YP_985989.1| 232721.Ajs_1723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]