SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145297666|ref|YP_001140507.1| from Aeromonas salmonicida subsp. salmonicida A449

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145297666|ref|YP_001140507.1|
Domain Number 1 Region: 23-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.33e-83
Family Phosphate binding protein-like 0.00000000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145297666|ref|YP_001140507.1|
Sequence length 333
Comment ABC-type sulfate transport system, periplasmic component [Aeromonas salmonicida subsp. salmonicida A449]
Sequence
MKLRMTALTLLSLLALGQANAAEIRLLNVSYDPTRELFQEYNGAFAKEWKAKTGDDVVVG
QSHGGSGKQARAVVDGLEADLVSLALAYDVNAVAKQGLIAADWQSRLANNASPYTSTIVF
LVRKDNPKQIKDWGDLVRKDIAIVTPNPKTSGGARWNYLAAWGYALKKSGSEEGAKQFVG
DLYKNVKVLDSGARGATTSFIERGLGDVLLAWENEALLVLNQPGNRDKFELVVPSVSILA
EPPVAVVDKVARKHGTEAVAKGYLEYLYSDEGQRIIAKYHYRPSNPAIQKETAAQFPQLT
LFTVKDLEGDWDKAQQKHFAQGGLFDQIYQPGG
Download sequence
Identical sequences A0A1Q4MIE4 A4SIN7
382245.ASA_0593 WP_005313731.1.10171 WP_005313731.1.13540 WP_005313731.1.1406 WP_005313731.1.2366 WP_005313731.1.23756 WP_005313731.1.28352 WP_005313731.1.29842 WP_005313731.1.36887 WP_005313731.1.40195 WP_005313731.1.41377 WP_005313731.1.46813 WP_005313731.1.49611 WP_005313731.1.51049 WP_005313731.1.51485 WP_005313731.1.52154 WP_005313731.1.53881 WP_005313731.1.57660 WP_005313731.1.5833 WP_005313731.1.62078 WP_005313731.1.75420 WP_005313731.1.79205 WP_005313731.1.86551 WP_005313731.1.8755 WP_005313731.1.91946 WP_005313731.1.93610 gi|145297666|ref|YP_001140507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]