SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145297677|ref|YP_001140518.1| from Aeromonas salmonicida subsp. salmonicida A449

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145297677|ref|YP_001140518.1|
Domain Number 1 Region: 36-203
Classification Level Classification E-value
Superfamily E set domains 6.44e-63
Family E-set domains of sugar-utilizing enzymes 0.0000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145297677|ref|YP_001140518.1|
Sequence length 485
Comment N-acetylglucosamine-binding protein A [Aeromonas salmonicida subsp. salmonicida A449]
Sequence
MTAHIYRTEECMAAKIQLNHVAAALALLASGGVLAHGYISQPESRNYLCNKGGNSQCGAV
QWEPQSVEGPSGFPQSGPQDGQIASAGSSRWSELNAQTSDRWTRREVQAGPFAISWTFTA
NHVTRNWRYYLTKQDWNPNQPLTRAAFDLTPFCVVDGNMVQPPKQVTHNCNLPERTGYQL
ILGVWEVGDTSNSFYNLIDANFKGGSQPPLSWSQGGTIYPSTDLAAGDKARALVFDASGG
RPDLQTELTITTTEQGQKNNWAHALASKINAEQSQIRAGQQNADNQFNPVYGQNPVYLKS
GSTLERVEIQLEQLQPPVGNDISVSGLESEYLLDDGKVTLDFTITAQGDLTVTNTLYDHG
GVAKGQSAADIKDSSQSFTMPLTGLSAGHHQLVIEAKPKAGGEALQQTLDLMLKDSAGGG
NYQFTFPQGLTSYTDGTKVLQPKNGKVYQCKPFPYRGWCSQWSASATQYEPGIGTNWQDA
WIALN
Download sequence
Identical sequences A4SIP8
gi|145297677|ref|YP_001140518.1| 382245.ASA_0604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]