SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145299785|ref|YP_001142626.1| from Aeromonas salmonicida subsp. salmonicida A449

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145299785|ref|YP_001142626.1|
Domain Number 1 Region: 412-502
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000726
Family Anti-sigma factor antagonist SpoIIaa 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145299785|ref|YP_001142626.1|
Sequence length 572
Comment sulfate permease [Aeromonas salmonicida subsp. salmonicida A449]
Sequence
MRDFFSLERWLPGLAGVGPLVGLYSCILPMLVYALFGTSRQLIVGPDAATCAVIAAVVTP
LAAGDATRHWQLVMTMTAMTGFWCLIASRFKLGVLADFLSRPILMGLLNGVAITIMVGQL
SKIFGFTFDERYLIERIASGAYYITQTHLPTLAMSLTALLTLLLAKRYKPAWPSSMVAMV
VTGALVWGFSLGDHEIATLGLVGSGLPAFQLPQFPPGLMRELVLPALNLAMVSFVSMMLT
ARSFAAKNGYEIDADKEFRALGMANLAAAASQGFAISGADSRTAVNDANGGKSQLVSIIA
AAVIAIITFYLTAPLQYIPTAALGVVLVMAALSLTDFRSLWALRHSDRSAFWLALITFIS
VLAMGVIPGITLAVLLGLFQFLRNVMRPTDQLLGMDDEGVVRTLGDNEQAKAIPGILVYR
FNSPLTYFNAPYFKRRVLALLVQDPHNPKCLVVDAVACFTHQDISVMSMVGELHRDLKRR
GIHMVMAGRHGQMSQWLKQAGIRVGDEGVILCPDMYQALRMTRCYREPVFKDDAVVESTT
DAILSHWPQDDALPDSARLTLPSEQEAGATLA
Download sequence
Identical sequences A0A1Q4MFX4 A4SPQ6
WP_005313031.1.10171 WP_005313031.1.13540 WP_005313031.1.1406 WP_005313031.1.2366 WP_005313031.1.28352 WP_005313031.1.29842 WP_005313031.1.36887 WP_005313031.1.40195 WP_005313031.1.41377 WP_005313031.1.46813 WP_005313031.1.49611 WP_005313031.1.51049 WP_005313031.1.51485 WP_005313031.1.52154 WP_005313031.1.53881 WP_005313031.1.57660 WP_005313031.1.5833 WP_005313031.1.62078 WP_005313031.1.79205 WP_005313031.1.86551 WP_005313031.1.8755 WP_005313031.1.91946 WP_005313031.1.93610 gi|145299785|ref|YP_001142626.1| 382245.ASA_2865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]