SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145301122|ref|YP_001143963.1| from Aeromonas salmonicida subsp. salmonicida A449

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145301122|ref|YP_001143963.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.31e-124
Family UbiD middle domain-like 0.000000000107
Further Details:      
 
Domain Number 2 Region: 323-485
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.7e-67
Family UbiD C-terminal domain-like 0.0000000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145301122|ref|YP_001143963.1|
Sequence length 489
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Aeromonas salmonicida subsp. salmonicida A449]
Sequence
MKYKDLRDFIAQLEQNGQLKRITREIDPYLEMTEISDRTLRAGGPALLFENPKGYSMPVL
TNLFGTPDRVAMGMGQPNVGALRQVGTWLSYLKEPEPPRGLKELMEKLPIFKQVLNMPTK
RLSSAPCQQLVLEGEAVDLDQIPIQHCWPGDVAPLVTWGLTITRGPYKKRQNLGIYRQQK
IGKNKLIMRWLDHRGGAIDFREWQEAHPGERFPVVVALGADPATILGAVTPVPDSLSEYA
FAGLLRGSRTEVVKALSCDLEVPASAEIVLEGYLEPGELAPEGPYGDHTGYYNEVDEFPV
FTITHMTMRRDAIYHSTYTGRPPDEPAVLGVALNEVFVPLLQKQFPEIVDFYLPPEGCSY
RMAVVTIKKRYPGHAKRVMLGVWSFLRQFMYTKFVIVCDDDINARDWKDVIWAITTRMDP
ARDTTLIEHTPIDYLDFASPVSGLGSKMGLDATNKWPGETNREWGQPIVQDEAVKQKVDS
IWAELNILG
Download sequence
Identical sequences A0A0W0AVD2 A0A1Q4MHS1 A0A290VFG0 A4STJ3 T0QZ13
WP_005320666.1.13540 WP_005320666.1.1406 WP_005320666.1.22899 WP_005320666.1.2366 WP_005320666.1.26439 WP_005320666.1.29842 WP_005320666.1.33624 WP_005320666.1.36887 WP_005320666.1.38021 WP_005320666.1.40195 WP_005320666.1.41377 WP_005320666.1.44620 WP_005320666.1.46813 WP_005320666.1.49680 WP_005320666.1.51485 WP_005320666.1.52154 WP_005320666.1.57660 WP_005320666.1.5833 WP_005320666.1.62078 WP_005320666.1.65925 WP_005320666.1.68758 WP_005320666.1.75420 WP_005320666.1.86551 WP_005320666.1.86591 WP_005320666.1.8755 WP_005320666.1.91946 WP_005320666.1.93610 gi|145301122|ref|YP_001143963.1| 382245.ASA_4291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]