SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148377342|ref|YP_001256218.1| from Mycoplasma agalactiae PG2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148377342|ref|YP_001256218.1|
Domain Number 1 Region: 6-236
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.9e-50
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000853
Further Details:      
 
Domain Number 2 Region: 246-345
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 8.24e-19
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148377342|ref|YP_001256218.1|
Sequence length 415
Comment DNA-damage repair protein MucB [Mycoplasma agalactiae PG2]
Sequence
MNNKNIIFHIDFDSYFVSAHRSKDHRLKNKPVAVSNGLSRSICSSISYELKNAGIKVGWP
RFMIEKKAPETIFVEPNFDLYYTTSNNIFDYIASNYTANIEVGSIDECWVDVTAIAEGKN
PVALARKLQEDINEIFDIPISIGISYSKWAAKIASDLAKPFGVKFIENHNDLETQIWPLN
IQKYYGIGEKTADKLIKADVKTIGQLARSSELNSDLYMIFRNRLSAFINEANGNGNDKLT
YEHNNLKGIGNELTFPLYDFYERSEIYKVIKNIAYKVSHRAQNRNVVGFTLTVIIRSVSK
VWKGKQMKLVEPTNDAEQIYKNAIILFEKLWKEQPIRGVGLRLTNLINEFEHFKQLTIFD
TYDDYKQESKVNNIINDINKKVGKVVLKTGYRVSKEKIKESVQSRYLEDDLGIRK
Download sequence
Identical sequences A5IXL3
WP_011949255.1.3023 347257.MAG_0740 gi|148377342|ref|YP_001256218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]