SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148377458|ref|YP_001256334.1| from Mycoplasma agalactiae PG2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148377458|ref|YP_001256334.1|
Domain Number 1 Region: 81-278
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4e-24
Family Endonuclease I 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148377458|ref|YP_001256334.1|
Sequence length 314
Comment ribonuclease [Mycoplasma agalactiae PG2]
Sequence
MINNKIIKHKFLASLGLISAPILSLTVLSSTGCNNKNSTTDNNYLIPEKSFYEKSNYYDS
LEGLNGNKLYSELVKIQHKHLSGIKSYKYLKTIYKDAFKDLYYEKDGSLLDIYSENPIGK
DPYNYSFNDSGSSAKSEGLGFNREHLVPQSWFKKEKLARQDAHHVWPTDILVNNKRDNYP
FGKVADAIFTSKNGTKIDSYLAEPIDEFKGDIARAHLYFAITHASRYEMHNQGNDVFKFL
DNKPLVNKYFDTYTKWAKKDQINLFDVVRNNEIAKHQNGLRSPFSDYPELIDLIINPGNK
VFVNKGVLRSNIAV
Download sequence
Identical sequences A5IXY1
gi|148377458|ref|YP_001256334.1| WP_011949371.1.3023 347257.MAG_1920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]