SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148377510|ref|YP_001256386.1| from Mycoplasma agalactiae PG2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148377510|ref|YP_001256386.1|
Domain Number 1 Region: 18-82
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.00000000000000222
Family Glucose permease domain IIB 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148377510|ref|YP_001256386.1|
Sequence length 92
Comment hypothetical protein MAG_2440 [Mycoplasma agalactiae PG2]
Sequence
MTKETKMIDTNNEQYNQPKQIISALGGLDNISKYRNCATKLRYDIVDKNLVNEDKLIETG
ASNINFVGDNHIQVKYGLKTVKLAKRDSEKSD
Download sequence
Identical sequences A5IY33
WP_011949421.1.3023 gi|148377510|ref|YP_001256386.1| 347257.MAG_2440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]