SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148377586|ref|YP_001256462.1| from Mycoplasma agalactiae PG2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148377586|ref|YP_001256462.1|
Domain Number 1 Region: 9-228
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.46e-59
Family G proteins 0.000000201
Further Details:      
 
Domain Number 2 Region: 301-395
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.41e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000221
Further Details:      
 
Domain Number 3 Region: 207-303
Classification Level Classification E-value
Superfamily Translation proteins 4.57e-29
Family Elongation factors 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148377586|ref|YP_001256462.1|
Sequence length 396
Comment elongation factor Tu [Mycoplasma agalactiae PG2]
Sequence
MAKLDFDRSKEHVNIGTIGHVDHGKTTLTAAIATVLAKKGLSEAKSYDAIDNAPEEKARG
ITINTSHIEYNTEKRHYAHVDCPGHADYIKNMITGAAQMDGSILVVAATDGAMPQTKEHV
LLAKQVGVPKMVVFLNKCDMIKPEDAEMIDLVEMEVRELLTKYGFDGDNTPFVRGSALQA
LQGKPEYEENILELMNAVDTWIETPVKDFEKPFLMAVEDVFTISGRGTVATGRVERGRLS
LNEEVEIVGLKPTKKTVVTGIEMFRKNLKEAQAGDNAGLLLRGVERSAIERGQVLAKPGS
IVPHAEFEAAIYALTKEEGGRHTPFFVNYKPQFYFRTTDVTGGLEFEKGREFVQPGENVN
LKVKLIAPIAVEEGTKFSIREGGRTVGYGSVTKILK
Download sequence
Identical sequences A0A059Y8L3 A0A2D2ARA7 A5IYA9 D3VQH9 E4PZX2 I5D613
WP_004024476.1.102037 WP_004024476.1.14198 WP_004024476.1.17077 WP_004024476.1.2028 WP_004024476.1.21240 WP_004024476.1.24405 WP_004024476.1.2669 WP_004024476.1.27818 WP_004024476.1.3023 WP_004024476.1.32249 WP_004024476.1.32382 WP_004024476.1.32703 WP_004024476.1.37991 WP_004024476.1.47380 WP_004024476.1.49663 WP_004024476.1.50201 WP_004024476.1.56049 WP_004024476.1.56372 WP_004024476.1.5772 WP_004024476.1.59238 WP_004024476.1.61074 WP_004024476.1.61437 WP_004024476.1.67253 WP_004024476.1.67779 WP_004024476.1.72194 WP_004024476.1.72927 WP_004024476.1.82377 WP_004024476.1.85199 WP_004024476.1.85958 WP_004024476.1.8756 WP_004024476.1.88257 WP_004024476.1.95878 gi|313678506|ref|YP_004056246.1| gi|339320969|ref|YP_004683491.1| gi|148377586|ref|YP_001256462.1| gi|291320269|ref|YP_003515530.1| 347257.MAG_3200 gi|392430053|ref|YP_006471098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]