SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148377771|ref|YP_001256647.1| from Mycoplasma agalactiae PG2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148377771|ref|YP_001256647.1|
Domain Number 1 Region: 159-330
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-49
Family G proteins 0.0000155
Further Details:      
 
Domain Number 2 Region: 3-156
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.96e-44
Family Obg GTP-binding protein N-terminal domain 0.0000193
Further Details:      
 
Domain Number 3 Region: 347-419
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 2.35e-17
Family Obg GTP-binding protein C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148377771|ref|YP_001256647.1|
Sequence length 422
Comment GTPase ObgE [Mycoplasma agalactiae PG2]
Sequence
MAKFIDEIKLTLIAGKGGDGIISFRREAHVDKGGPDGGDGGKGGNIYFVGDKGKNTLLSL
YGNKQISAEDGINGGPKNLYGATGKSTYVKVPIGTMVFKNDKLVADIIEEKEYLVAQGGI
GGRGNAKFKSNRNTAPRICENGTPGEKYLAHIVLKVMSDVGIIGKPSAGKSTLLSAISNA
KAKIAEYEFTTLVPQLGLVKYHDHSFTVADLPGLIKGASEGKGLGIQFLRHIERCRVVVQ
IIDFGSEEKNPIEDFEIINKELEEYSKKLASKPKVVVANKSDLQGFKERVNIFKAKYPDV
EIVEISAIERQNLEELKGKIWKILEEAKLLPADEEEETEENVEIKLEDDYKISNPYAGFF
EITGPKIEQIYHKIPLVSYDNLIRFNTMLKKIGVWDDLLKYDIKPGDTVRILDYEFEWDG
EF
Download sequence
Identical sequences A5IYU8
WP_011949675.1.3023 gi|148377771|ref|YP_001256647.1| 347257.MAG_5090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]