SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148377818|ref|YP_001256694.1| from Mycoplasma agalactiae PG2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148377818|ref|YP_001256694.1|
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily L21p-like 3.92e-31
Family Ribosomal protein L21p 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148377818|ref|YP_001256694.1|
Sequence length 99
Comment 50S ribosomal protein L21 [Mycoplasma agalactiae PG2]
Sequence
MIAIIETGGKQILVKEGETIFIEKIEGAEGSKVTFDKVLLLDNKIGKPYVESAKVIGEIQ
KQGKAKKIVVYRHNAKSTHKRKLGHRQPYTRVKITGIVG
Download sequence
Identical sequences A5IYZ6 D3VR78
gi|291320515|ref|YP_003515779.1| gi|148377818|ref|YP_001256694.1| 347257.MAG_5550 WP_011949713.1.24405 WP_011949713.1.3023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]