SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148377871|ref|YP_001256747.1| from Mycoplasma agalactiae PG2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148377871|ref|YP_001256747.1|
Domain Number 1 Region: 6-84,176-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.19e-57
Family Bacterial dinuclear zinc exopeptidases 0.0000662
Further Details:      
 
Domain Number 2 Region: 74-184
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.05e-25
Family Aminopeptidase/glucanase lid domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148377871|ref|YP_001256747.1|
Sequence length 362
Comment aminopeptidase [Mycoplasma agalactiae PG2]
Sequence
MNKGEFKNRLVKYLEAEGVSRYESNIAKMMEAEINQNNCFTVSYDNFGSIIFHKKSKYPN
APKFMVAAHMDEVGFLVKGIHENGQIKLSSVGGLWPSVVIGTKAVLINSNGKRFNGVFGH
TSIHIMEAEKRSKALTMDDLYADFGFFSEQEAKDNGIEVGNVVLMTGETVYLDNPDLLAG
KAMDNRAGVCVLEYIAKELENVDLGVDLYLVGTVQEEVGTRGAKTSVSLINPEFAIALDT
TSTHDTVGTIKGTTVIGKGAAIRVKDGGMMANPQLVEFMCKIGRENNIKHYKFISMGGGT
DAAELQYAKGGAITLTISLPQRYLHSPIGLISINDLIDSANLIAQTIKAINADVYATIFK
YK
Download sequence
Identical sequences A5IZ49
WP_011949765.1.3023 347257.MAG_6080 gi|148377871|ref|YP_001256747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]