SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148377900|ref|YP_001256776.1| from Mycoplasma agalactiae PG2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148377900|ref|YP_001256776.1|
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.0000000000000419
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148377900|ref|YP_001256776.1|
Sequence length 94
Comment Pentitol phosphotransferase enzyme II, bcomponent [Mycoplasma agalactiae PG2]
Sequence
MKVLCLCGSGMGTSMIIKLKTEQAMRELGIQGSVEALGLGMGKSVANNFDVILCTNNFVS
EVANSKASVHGLKNVMDINEIKAAFKDALAKGIK
Download sequence
Identical sequences A5IZ78 D3VRI9
WP_011949791.1.24405 WP_011949791.1.3023 gi|148377900|ref|YP_001256776.1| 347257.MAG_6370 gi|291320625|ref|YP_003515890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]