SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119866428|ref|YP_936380.1| from Mycobacterium sp. KMS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119866428|ref|YP_936380.1|
Domain Number 1 Region: 5-296
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 5.23e-41
Family ADP-ribosylglycohydrolase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119866428|ref|YP_936380.1|
Sequence length 301
Comment ADP-ribosylation/crystallin J1 [Mycobacterium sp. KMS]
Sequence
MGDASVRSRIRAGLLAYAAGDAAGVPWEGCLAAEIDRPGIDELPRRGDWPPGATSDDTAL
TLLVAEYLRDRGAVVEEADFLTRLAAAAPHIRGIGPSTRAAVDRFRTRGALHAETGDTNG
AAMRALPIGWAVADDGLRRTVTTGLSRTTHGAASAVAAACIASAMASAAVDGSSLFDAAA
TEIDWAETQFGIELRPVRDAVDGRWRPGRNGVSLEAVGAVAAVVDVVRHADVGHLSVADA
LRYAVSLGGDTDTAAAIAGGILGGRVTGTPDIPWLDRVDLPDGATLDGLSAALAELRAST
G
Download sequence
Identical sequences A1U9T2
WP_011557790.1.20321 WP_011557790.1.47369 gi|108797343|ref|YP_637540.1| gi|119866428|ref|YP_936380.1| 164756.Mmcs_0363 189918.Mkms_0373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]