SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148243607|ref|YP_001228764.1| from Synechococcus sp. RCC307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148243607|ref|YP_001228764.1|
Domain Number 1 Region: 375-851
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 6.54e-142
Family Aconitase iron-sulfur domain 0.00000000000243
Further Details:      
 
Domain Number 2 Region: 170-368
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 2.04e-62
Family LeuD-like 0.0000002
Further Details:      
 
Domain Number 3 Region: 9-168
Classification Level Classification E-value
Superfamily Aconitase B, N-terminal domain 7.72e-57
Family Aconitase B, N-terminal domain 0.00000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148243607|ref|YP_001228764.1|
Sequence length 867
Comment bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase [Synechococcus sp. RCC307]
Sequence
MSLTPDAFLPAYRAAAAEREGLGVPPLALDAEQTKALTDLLETPSTGEEQTLLHLLSERI
PPGVDEAAYVKADWLSAVAEGRRSSPLVAPLEATRLLATMIGGYNVAALIRLLSNTDNSL
AAAAAEGLSRTLLVYDAYNDVLELAAGNSYAKQVIDSWAEAEWFTAKPELPESITVTVFK
VEGETNTDDLSPATHATTRPDIPLHATAMLETRMPGGLEQLEALKAKGLPVAYVGDVVGT
GSSRKSAINSVLWHTGSDIPHVPNKRSGGVILGGKIAPIFFTTAEDSGALPIECDVTGLN
SGDVITIRPHAGTIERDGEVVARFDLKPSTISDEVRAGGRIPLMIGRALTDKVRSQLGLP
ASELFIRPTPPADSGKGFTLAQKMVGRACGLPGVHPGTSCEPLMTSVGSQDTTGPMTRDE
MKELACLGFSADLVMQSFCHTAAYPKPVDLKTHAELPDFMSNRGGVSLRTGDGIIHSWLN
RMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAFAAAIGAMPLDMPESVLVRFSGELQPGV
TLRDVVNAIPYVAIEKGLLTVEKAGKKNVFNGRIMEIEGLPDLKLEQAFELTDATAERSC
AGSTIKLSVDTVSEYLRSNVALLKNMIARGYSDARTLARRIKAMEDWLANPELLEADANA
DYAAVIDIDLNTITEPIVACPNDPDNVKTLSDVAGDKVDEVFIGSCMTNIGHYRAAATVL
KGQGQNTARLWVCPPTRMDEETLKAEGYYATFEAAGSRMEMPGCSLCMGNQARVEDNTTV
FSTSTRNFNNRLGNGAQVYLGSAELAAVCAQLGRIPSREEYLAVAAERIDPNSAELYRYL
NFDQVQGFADEGRVLSQAEEEKLLAEA
Download sequence
Identical sequences A5GX02
gi|148243607|ref|YP_001228764.1| 316278.SynRCC307_2508 WP_011936920.1.22971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]