SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148241518|ref|YP_001226675.1| from Synechococcus sp. RCC307

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148241518|ref|YP_001226675.1|
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.93e-18
Family 2Fe-2S ferredoxin-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148241518|ref|YP_001226675.1|
Sequence length 146
Comment ferredoxin [Synechococcus sp. RCC307]
Sequence
MPVVRFVREGREVLCPPGTNLRELALQEGVELYGLKGRLGNCGGCGQCITCFVEVVAERK
EGALTPLTPVEQQKLRRRPESWRLACQALVQESVAVLTRPQAGRDAQKQAIAAAQAEPLP
EGRMPEPDPEEGADDEVDSGAESDEL
Download sequence
Identical sequences A5GR13
WP_011934837.1.22971 gi|148241518|ref|YP_001226675.1| 316278.SynRCC307_0419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]