SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148544003|ref|YP_001271373.1| from Lactobacillus reuteri DSM 20016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148544003|ref|YP_001271373.1|
Domain Number 1 Region: 3-280
Classification Level Classification E-value
Superfamily DAK1/DegV-like 3.66e-81
Family DegV-like 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148544003|ref|YP_001271373.1|
Sequence length 280
Comment degV family protein [Lactobacillus reuteri DSM 20016]
Sequence
MAKIKIVCDSSAGLTDEEIKKYDITIIPLSVMIDGTVYVERETITNEQFPEMMKNAKSLP
KTSQPPIGKFVDAFDKLGEDGSEVLCVTMMESISGTVHAAEQAAGMTKTKVTVYDSQTTD
RAMAFQIIEAAKVIENGGSVQEAIERMKYIFDHSKVYLAIDNLDNLVAGGRISKFAGALS
NLLNIKVMLQIADGQIHIIMKGRGKKALHKEWDRILNEMKNGPKVMGAGISHVEGNSEVN
RLLTKIKAFEPNLDIVVRETVPIIATHTGMGACCLLYYTE
Download sequence
Identical sequences A0A0U5JUS8 A5VJL2 C0Z184
WP_003668100.1.2821 WP_003668100.1.3665 WP_003668100.1.48856 WP_003668100.1.8717 WP_003668100.1.97761 WP_003668100.1.9821 WP_003668100.1.9859 gi|184153397|ref|YP_001841738.1| gi|148544003|ref|YP_001271373.1| 557433.LAR_0742 557436.Lreu_0772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]