SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148544162|ref|YP_001271532.1| from Lactobacillus reuteri DSM 20016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148544162|ref|YP_001271532.1|
Domain Number 1 Region: 1-283
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.91e-86
Family DegV-like 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148544162|ref|YP_001271532.1|
Sequence length 292
Comment degV family protein [Lactobacillus reuteri DSM 20016]
Sequence
MKIAVVTDSTAYLSPEEAAANNIHVVPIPVTLDGQTYREGVDISTSDFYEKMANSSSFPT
TSQTPIGQLMEVYQGLADDGYDAVISIHLTRAITGYLDTVEQLAEQMKDTIKIVPIDSHL
TVKMMGYLALEAAKLASEGDDLDDIVKKVKEYRDTFNNVFVVDDLQNLVRGGRLSNASAF
VGSILKIKPLLTMHTPTYAIEAFEKVRSMKKAKLRCEQIFDEDIAKLDYPVKAMVIHANV
PEEGQKWLDKLQADHPDISFELSYFGPVIGSHLGQGALALAWMQDTAKKPLA
Download sequence
Identical sequences A0A1B7LUB5 A5VK21 C0Z0C5
WP_003667851.1.2821 WP_003667851.1.3665 WP_003667851.1.48856 WP_003667851.1.8717 WP_003667851.1.97761 WP_003667851.1.9821 WP_003667851.1.9859 gi|148544162|ref|YP_001271532.1| 557433.LAR_0879 557436.Lreu_0933 gi|184153534|ref|YP_001841875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]