SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148544749|ref|YP_001272119.1| from Lactobacillus reuteri DSM 20016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|148544749|ref|YP_001272119.1|
Domain Number - Region: 78-149
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00125
Family APH phosphotransferases 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148544749|ref|YP_001272119.1|
Sequence length 465
Comment hypothetical protein Lreu_1537 [Lactobacillus reuteri DSM 20016]
Sequence
MINQNLDIFDLRKIQINKTKAELENNGKRQQKVVSSDMLGTFTPVDRDPVKIIQITEANM
IPELLPLRHQRMIASRFSFFRGTAELMEHDLKRQAQSNLPIIICGDAHVNNFGFYASPER
KLLFGLNDFDEARIGNWESDLKRLLVSAELAGEENGFDRNDLYHLLQLTTKTYRHTIKSA
NKMSLSQLFYFSFAYEDMGKAIESFGDISTQMQTVLNKVLKKSQRSNSEEIIQKMATINN
QGHLVFRDNPPRARHLSAVRYQQIVKGYNKYRENVRQDVRVLLANFHISDIIRYSVGVGS
FGTRCYLIMLTGNDNSHIVLQVKEAMPLRYNLLSLPVQQVIRNGGIAGQRIVTAQRVLQS
SSDRFLGSTTFGGRSYYIRQFRDMKESINVNKLDFESFQFYCQTCAYLLAMAHFQSPTAP
MIRGYLKHQKILDTLLPNWALRYVDQVTADYGQFKLAIAKGKLIN
Download sequence
Identical sequences A0A1B7LRS9 A5VLQ8 C0YYF2
WP_003668864.1.2821 WP_003668864.1.3665 WP_003668864.1.48856 WP_003668864.1.8717 WP_003668864.1.97761 WP_003668864.1.9821 WP_003668864.1.9859 557433.LAR_1446 557436.Lreu_1537 gi|148544749|ref|YP_001272119.1| gi|184154101|ref|YP_001842442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]