SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148543396|ref|YP_001270766.1| from Lactobacillus reuteri DSM 20016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148543396|ref|YP_001270766.1|
Domain Number 1 Region: 33-356
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.57e-63
Family ADP-ribosylglycohydrolase 0.0000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148543396|ref|YP_001270766.1|
Sequence length 361
Comment ADP-ribosylation/crystallin J1 [Lactobacillus reuteri DSM 20016]
Sequence
MKKKHYEKAKDTYSNFAEFDLTLGAWGVFMRDKDKILGALYGQAIGDSMGMPTELWPIQK
IRDKFGRNITTFLDGTDDNDIAINFKAGEYTDDTNQAFAILDALIETNWEPDTKVLVKHI
MKWADAVGVWTNNILGPSSKAALKLVKEGKNPSEVTKTALTNGCGMRISPIGTLYEPEDF
DQLIEMVYEVTKITHSSDVSISGAAMIAGAVTAAMADYDWDDIIDYAKKANDAGFKLGTP
TWAAHNKERLEVGIALAHKYEGNDEAFSRAISNTVGTGTTISESIPAALAIAYYAKDVKK
SAFICTNLGGDTDTIGAMATAICGAKVGAKNIPEDWKKLIDEKNPQHNIQEFADKISEFK
A
Download sequence
Identical sequences A5VHV5 C0YXI2
gi|148543396|ref|YP_001270766.1| 557436.Lreu_0157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]